KEGG   Rattus norvegicus (rat): 64822Help
Entry
64822             CDS       T01003                                 

Gene name
Fabp9, Tlbp
Definition
(RefSeq) fatty acid binding protein 9
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 64822
NCBI-ProteinID: NP_074045
RGD: 620285
Ensembl: ENSRNOG00000011082
UniProt: P55054
Position
2q23
AA seq 132 aa AA seqDB search
MIEPFLGTWKLVSSENFENYVRELGVECEPRKVACLIKPSVSISFNGERMDIQAGSACRN
TEISFKLGEEFEETTADNRKVKSLITFEGGSMIQIQRWLGKQTTIKRRIVDGRMVVECTM
NNVVSTRTYERV
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacccttcttggggacctggaaactggtctccagtgaaaacttcgagaattac
gtgagggaactgggagtggaatgtgaaccccggaaagttgcatgtttaataaagccaagt
gttagcattagtttcaatggggaaaggatggacatccaagcaggaagtgcatgcaggaac
acggagatctccttcaaattgggggaagagtttgaagagaccactgcagacaaccggaaa
gtgaagagccttataacttttgaaggtgggtcaatgatccagatccaaagatggcttggc
aaacagacaacaattaaaagaagaattgtggatggaagaatggtagtggagtgcaccatg
aacaatgttgtcagcactaggacctacgaaagggtgtag

DBGET integrated database retrieval system