KEGG   Rattus norvegicus (rat): 64823
Entry
64823             CDS       T01003                                 

Gene name
Csnk1g3
Definition
(RefSeq) casein kinase 1, gamma 3
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64823 (Csnk1g3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64823 (Csnk1g3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64823 (Csnk1g3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   64823 (Csnk1g3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 64823
NCBI-ProteinID: NP_074046
RGD: 621408
Ensembl: ENSRNOG00000016677
UniProt: Q62763
Position
18q11
AA seq 448 aa
MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKAQQV
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKP
DYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKIQQS
KNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITA
PTEVEVMDETKCCCFFKRRKRKTIQRHK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggataataaaaagaaagacaaggacaaatcagatgacagaatggcacggcccagtggt
cggtcagggcacagcactcgaggaactgggtcttcttcatctggagttttaatggttgga
cctaactttagagttgggaaaaaaattggatgtggcaattttggagaattacgattaggg
aaaaatttatatacaaatgaatatgtggcgattaaactggagcccatgaaatccagagca
ccacagctgcatttggaatacagattctataagcagttaggatctggagatggtatacct
caagtttactattttggcccttgtggtaaatacaacgctatggtgctggaactgctggga
cctagtttggaagatttgtttgacctctgtgatagaacattttctcttaaaaccgttctc
atgatagctatacagctgatttctcgcatggagtatgtccactcaaagaacttgatatac
agagatgtgaagcccgagaatttcttaataggacggccaggaaacaaagcccagcaagtc
attcacatcatagattttggtttggcaaaggaatatattgatccagagacaaagaaacat
ataccatacagagaacacaaaagccttactggaacagccagatacatgagcataaacaca
catctaggaaaagaacagagcagaagagacgatttagaagctttaggacatatgttcatg
tatttcctgagaggcagtcttccttggcaaggcctaaaggcagatacattaaaagagaga
tatcagaaaattggagacacaaaacgagccacaccgatagaagtgctgtgtgaaaacttc
ccagaagaaatggcaacatatcttcgttacgtacgaaggctagatttttttgaaaagcca
gactatgattacttaagaaagctttttactgacttgtttgatcgcaaagggtatatgttt
gattatgaatatgactggattggtaaacagttgcctactcctgtaggtgcagttcagcaa
gacccggctctgtcatcgaacagagaagcacaccaacacagagacaagatacagcagtct
aaaaaccagtcggcagaccacagggcagcttgggactcccagcaggcaaatccccaccat
ttgagagctcaccttgcagcagacagacatggtggctcggtacaggttgtaagttctaca
aatggagagctaaacacggatgaccccacggcgggacggtcaaatgcacccattacagcc
cctacggaagtagaagtgatggatgaaaccaagtgctgctgctttttcaaacgaaggaaa
aggaaaaccatacaacgtcacaagtga

DBGET integrated database retrieval system