KEGG   Rattus norvegicus (rat): 64824
Entry
64824             CDS       T01003                                 

Gene name
Nab1
Definition
(RefSeq) Ngfi-A binding protein 1
  KO
K22388  NGFI-A-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    64824 (Nab1)
SSDB
Motif
Pfam: NCD2 Nab1 NCD1
Other DBs
NCBI-GeneID: 64824
NCBI-ProteinID: NP_074047
RGD: 70882
Ensembl: ENSRNOG00000012959
UniProt: Q62722
Position
9q22
AA seq 485 aa
MATALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMAS
KPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCNSYERSSSA
REPHLKVPKCAATTCVQSLGQGKSEVGSLALQSVSESRLWQGHHTTESEHSLSPADLGSP
ASPKESSEALDAAAALSVAECVERMAPTLPKSDLNEVKELLKNNKKLAKMIGHIFEMSDE
DPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALA
RQVSREVTYKYTYRTTRLKCGERDELSPKRIKMEDGFPDFQESVPTLFQQARAKSEELAG
LSSQAEKGMAKQMELLCAQAGYERLQQERRLMAGLYRQSSGEQSPDGGLPSDGSDGQGER
PLNLRIPSVQNRQPHHFVVDGELSRLYSNEVKSHSSESLGILKDYPHSAFTLEKKVIKTE
PEDSR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggccacagccttacctaggaccctgggagagctgcagctgtatcgaatattgcagaaa
gctaatctgctttcttactttgatgcctttatccaacaaggtggtgatgatgtccagcaa
ctgtgcgaagctggagaagaagaatttttggaaatcatggcactggtgggcatggcaagc
aagccccttcatgttagacggcttcagaaggctttgagagattgggttacaaatcctggc
cttttcaaccagccattgacttcccttcctgtcagtagcatacccatctataaattacca
gagggatcaccaacatggctgggaatatcctgcaatagttatgaaaggagtagcagtgcc
cgagagccacatttaaaggtccctaaatgcgctgccaccacctgtgttcagagcttgggt
cagggcaagtcagaggtgggaagtctagcactgcagagtgtcagtgaatccagactctgg
caaggacaccacaccactgaaagcgagcatagtctctccccagcagacctgggctcccca
gcctccccaaaggaaagcagtgaagccctggatgctgccgccgcgctctctgtggccgag
tgtgtggagcggatggcccccacgctgcccaaaagtgacttgaatgaagtgaaagagctg
ctgaagaacaataagaagttggccaaaatgattggtcacatcttcgagatgagcgacgag
gatccacacaaggaggaggagatcagaaagtacagcgccatctatgggcgatttgactcc
aaaagaaaggatggtaaacacctcacattgcatgagctcacggttaacgaggcagctgct
cagctgtgtgtgaaggacaatgccctgctgacgagaagagatgagcttttcgccctggcc
aggcaggtttctcgagaagttacctacaaatacacttacaggaccaccaggttaaaatgt
ggtgaaagagatgaattgtctccaaagagaattaaaatggaggatggatttccggacttc
caggaatctgtgccaacactcttccagcaggccagagccaaaagtgaagagcttgcaggt
ctcagttcacaggctgagaaggggatggcaaagcaaatggagctcctgtgtgcccaggcc
ggctatgagaggctgcagcaggagaggagactcatggccgggctctacaggcagagctct
ggagagcagagccctgatggcggccttccttctgatggctccgatggacaaggagaaagg
cctttgaatctccgaattcctagtgtgcagaacagacagccccatcattttgtggtggat
ggggagctcagtagactttactccaacgaggtgaagtcccactcatcagagagccttggg
attctaaaagactatcctcactctgcattcaccttggaaaagaaagttattaaaacagag
cccgaagactcaagatag

DBGET integrated database retrieval system