KEGG   Rattus norvegicus (rat): 64828
Entry
64828             CDS       T01003                                 

Gene name
B4galnt1
Definition
(RefSeq) beta-1,4 N-acetylgalactosaminyltransferase 1 precursor
  KO
K00725  (N-Acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase [EC:2.4.1.92]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    64828 (B4galnt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    64828 (B4galnt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.92  (N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase
     64828 (B4galnt1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Glycolipid
   64828 (B4galnt1)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_transf_64
Other DBs
NCBI-GeneID: 64828
NCBI-ProteinID: NP_074051
RGD: 620490
Ensembl: ENSRNOG00000004839
UniProt: Q10468
Position
7
AA seq 533 aa
MRLDRRALYALVLLLACASLGLLYASTRDAPGLPNPLALWSPPQGPPRLDLLDLATEPRY
AHIPVRIKEQVVGLLAQNNCSCESSGGRFALPFLRQVRAIDFTKAFDAEELRAVSISREQ
EYQAFLARSRSLADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQEASVQEIYQVNL
IASLGTWDVAGEVTGVTLTGEGQSDLTLASPILDKLNRQLQLVTYSSRSYQANTADTVRF
STKGHEVAFTILIRHPPNPRLYPPSSLPQGAQYNISALVTVATKTFLRYDRLRALIASIR
RFYPTVTIVIADDSDKPERISDPHVEHYFMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFV
FTARTRLEKLVDVLERTPLDLVGGAVREISGYATTYRQLLSVEPGAPGFGNCLRQKQGFH
HELAGFPNCVVTDGVVNFFLARTDKVRQVGFDPRLNRVAHLEFFLDGLGSLRVGSCSDVV
VDHASKVKLPWTSKDPGAELYARYRYPGSLDQSQVAKHRLLFFKHRLQCMTAE
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgcggctggaccgccgggccctctatgcgctagttctgctgcttgcctgcgcctcgctg
ggtctcctgtacgccagcacccgagacgcgccaggtctcccgaaccctctggcattgtgg
tcacccccacaaggtcccccgaggctcgatctgctagaccttgccactgagcctcgctac
gcacacatcccagtcaggatcaaggagcaagtggtggggctgctggctcagaacaattgc
agttgtgagtccagcggaggacgctttgccttgccgttcctgaggcaggtccgggcgatt
gacttcactaaagcctttgacgccgaggagctgagggctgtttctatctccagagagcag
gaataccaggccttccttgcaaggagccggtccctggctgaccagctgctgatagcccct
gccaactcccccttacagtatcccctgcagggtgtggaggttcagcccctcaggagcatc
ctggtgccagggctaagtctgcaggaagcttctgttcaggaaatatatcaggtgaacctg
attgcttcccttggcacctgggatgtggcaggggaagtaacaggggtgactctcactgga
gaggggcagtcggacctcacccttgccagcccaattctggataaactcaaccgacagctg
caactggtgacttacagcagccggagctaccaagccaacacagcagacacagtccggttc
tccaccaagggacatgaagtggccttcaccatcctcataagacatcctcccaacccccgg
ctgtacccaccatcatccctaccccaaggagcccagtacaacatcagtgctctggttacc
gttgccaccaagacctttcttcgttatgatcggctacgggcactcattgccagcatcaga
cgcttttaccctacggtcaccatagtaatcgctgacgacagcgacaaaccggagcgaatt
agcgacccccatgtggagcactatttcatgcccttcggcaagggttggtttgcaggtcgg
aacctggcggtgtcccaagtaaccaccaaatacgtgctgtgggtggacgacgactttgtc
ttcacggcgcgcacgcggctggagaagcttgtggatgtcctggagaggacgcccctggac
ttggttgggggcgcggtgcgggagatctcgggctacgctaccacctaccgacagctgcta
agtgtggagccgggcgccccaggctttgggaactgcctccggcaaaagcagggcttccac
cacgagctcgctggctttccaaactgcgtggtcaccgacggcgtagtcaacttcttcctg
gcgcgcacagataaagtgcgccaggtgggctttgacccacgcctcaaccgggtggctcat
ctggaattcttcctggatggtcttggttcccttcgagttggctcctgctctgatgttgtt
gtggatcatgcgtcaaaggtgaagctgccttggacatcaaaggatccaggggctgaactt
tatgcccgttaccgttacccgggatcactggaccaaagtcaggtggccaaacatcgactg
ctcttcttcaaacaccggctacagtgcatgaccgccgagtaa

DBGET integrated database retrieval system