KEGG   Rattus norvegicus (rat): 64829
Entry
64829             CDS       T01003                                 

Gene name
Unc13a, Munc13-1, Unc13h1
Definition
(RefSeq) unc-13 homolog A
  KO
K15293  protein unc-13 A/B/C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    64829 (Unc13a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64829 (Unc13a)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    64829 (Unc13a)
SSDB
Motif
Pfam: C2 Membr_traf_MHD DUF1041 C1_1
Other DBs
NCBI-GeneID: 64829
NCBI-ProteinID: NP_074052
RGD: 619722
Ensembl: ENSRNOG00000018452
UniProt: Q62768
Structure
PDB: 

Position
16p14
AA seq 1735 aa
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIMADSEICGTKDPTFHR
ILLDAHFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDQQDKPLPVPSSQCCNWNYF
GWGEQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYSD
SMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSELDDERDRDSY
HSCHSSVSYHKDSPRWDQDEEDLEDLEDLEDEELPEEEELEEEELEEEEELEEEELELEE
EEEVPDDLASYTQQEDTTVAEPKEFKRISFPTAAPQKEDKVSAVPIEAPDVSKGIPKAAT
PEEKAAAECAQEAEPPKSEESFRSREAEEGQEGQDAMSRAKANWLRAFNKVRMQLQEARG
EGEMSKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTL
NNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTEC
GVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQE
VFAVTKSAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGK
TKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVLDEDDDIKSRVKQRFKRESDDFLGQ
TIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLF
HFVTDVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSK
YMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRID
LSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNST
YEYIFNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYT
PCLNQFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEY
VAELPTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSC
SVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKE
KEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATS
FQPHIEECVRQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICE
KTVLKRVLKELWKLVMNTMERTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQ
MIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEK
SPDLQSLRYALSLYTQATDLLIKTFVQTQSAQVHGGKGTRFTLSEDVCPEMGSGVEDPVG
EVSVHVELFTHPGTGEQKVTVKVVAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKFATK
SKNNSWAPKYNESFQFSLSADAGPECYELQVCVKDYCFAREDRTVELAVLQLRELAQRGS
AACWLPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
NT seq 5208 nt   +upstreamnt  +downstreamnt
atgtctctgctgtgcgtgggagtcaaaaaagccaagtttgacggtgcccaagagaagttc
aacacatacgtgacgctgaaggtgcagaacgtgaagagcactaccatagctgtacgcggc
agccagcctagctgggagcaggacttcatgtttgagatcaaccgcctggatctgggcctg
acggtggaggtgtggaacaagggtctcatctgggacacaatggtgggtactgtgtggatc
ccacttcggaccatccgtcagtccaatgaggagggtccgggagaatggctgacactggac
tctcaggccatcatggcggacagtgagatctgtgggaccaaggaccccaccttccaccgc
atcctcctggacgcacattttgagctgcctttggacatccccgaggaggaggcgcgctac
tgggccaagaagctggagcagctgaatgccatgcgtgaccaagatgagtactcctttcag
gaccagcaggacaagccactgccggtgcccagcagccagtgctgcaactggaattacttt
ggctggggagaacagaatgatgatcccgacagtgccgtggatgaccgggacagtgattat
aggagtgagacgagcaacagcatcccaccgccttactacacgacttcgcagcccaatgct
tcggtgcaccagtactccgtgcggccaccccctctggggtcccgggagtcctacagcgac
tccatgcacagctatgaagagttctctgagccgcgggcactcagtcccacaggcagcagc
cgctatgcttccagtggggagctgagccagggcagctcccagctgagtgaggacttcgac
ccggatgagcacagcctacagggctcagagctggatgacgagagggaccgagattcttat
cactcctgccacagctctgtgagctaccacaaggactcaccccgctgggaccaggatgag
gaggacctggaggacctggaggacctggaagatgaggagttgcccgaggaagaggagttg
gaagaggaggagttggaggaggaggaggagttggaggaagaggaattggagttggaggag
gaggaggaggtgcctgatgacctggccagctatacccagcaggaggacaccactgtggct
gagcccaaagagttcaagcggatcagcttcccaacagctgcacctcagaaggaagacaaa
gtttcagctgtgcccattgaggcccccgatgtgtccaaaggcatccccaaggcagccaca
cctgaagagaaggcagctgcggagtgtgcacaggaagcggagccccccaagtctgaggag
agtttcagatctcgagaggctgaggagggccaggaagggcaggatgccatgtccagggcc
aaagccaactggttgcgagccttcaacaaggtgcgcatgcagctgcaggaggcccgagga
gaaggagagatgtccaagtctctgtggttcaaaggcggccctggtggtggccttatcatc
attgacagcatgccagacatcaggaagcggaagcccattcccctcgtgagcgacctggct
atgtctctggtccagtcacggaaggcgggcatcacctcggccttggcctccagcacgttg
aacaatgaagagttgaaaaaccacgtttacaagaagaccctgcaagccttaatctacccc
atctcctgcaccacgccgcacaacttcgaggtgtggacggccaccactcccacctactgc
tacgagtgcgaggggctgctgtggggcatcgcgcggcagggcatgcgctgcaccgagtgc
ggcgttaagtgccacgagaagtgccaagacctgctcaacgcggactgcctgcagcgggcg
gctgagaagagttctaagcatggcgctgaagaccgcacgcagaacatcatcatggtgctg
aaggaccgcatgaagatccgcgagcgcaacaagcctgagatcttcgagctgatccaggag
gtcttcgcggtcaccaagagcgcacacacacagcagatgaaggccgtcaagcagagtgtg
ctggatggcacatccaagtggtctgccaaaattagcatcacggtggtctgtgcccagggc
ttgcaggccaaggacaagacaggatccagtgacccttatgtcaccgtccaggttgggaag
accaagaaaaggacaaaaaccatctacgggaaccttaacccagtgtgggaagagaatttc
cactttgaatgtcacaactcctctgaccggatcaaggtgcgtgtgttggatgaagacgat
gacatcaaatcccgtgtgaagcaaaggtttaagagggagtctgatgacttcctagggcag
acaatcatcgaggtgcggacgcttagcggcgagatggatgtgtggtacaatctggacaag
agaacagacaagtctgctgtgtcgggcgccattcggcttcacatcagtgtggagatcaaa
ggggaggagaaggtggcaccctaccatgtccagtacacctgtctgcatgagaacctgttc
cattttgtgacggatgtacagaacaatggcgtggtgaagattcccgatgccaaaggtgac
gacgcctggaaggtttactatgatgagactgcccaggagatcgtggatgagtttgccatg
cgctatggcgttgaatccatctaccaagccatgacccactttgcctgcctctcctccaag
tacatgtgccctggggtacccgctgtcatgagcaccctgcttgccaacatcaacgcctac
tacgcacacaccaccgcctccaccaacgtgtctgcctccgaccgcttcgctgcctccaat
ttcgggaaagagcgctttgtgaaacttctggaccagctgcacaactccctgcggattgac
ctgtccatgtaccggaacaacttcccggccagcagccccgagcggctgcaggatctcaag
tccacagtggacctgcttaccagcatcaccttcttccggatgaaggttcaggaactgcag
agtccgccacgtgccagtcaggtggtgaaggactgcgtgaaggcgtgcctcaactccacc
tacgagtacatcttcaacaactgtcatgagctctatggccgggagtaccagacagacccg
gccaagaagggggaggtccccccggaggagcaaggccctagcatcaagaacctggatttc
tggtccaagctcatcaccctcatcgtgtctatcattgaggaggataagaactcctacaca
ccctgcctcaatcagtttccccaggagctgaatgtggggaagatcagtgctgaggtgatg
tggagcctgtttgcccaggacatgaagtacgccatggaggaacacgacaagcaccggctg
tgtaagagcgcagactacatgaacctgcatttcaaggtcaagtggttgtacaacgagtac
gtggctgaactgcccaccttcaaggaccgcgtgccggagtaccctgcgtggtttgagccc
ttcgtcatccagtggttagatgagaatgaggaggtgtcccgggacttcctgcatggtgca
ctcgagcgggacaagaaggatgggttccagcagacatcggagcacgccctgttctcttgc
tcggtagtggacgtcttctcccagctcaaccagagctttgagatcatcaagaagctggag
tgtcctgacccccagattgtgggccactacatgcggcgctttgccaagaccattagcaat
gtgcttctccagtacgccgacatcgtctccaaggacttcgcttcctactgctccaaggag
aaggagaaagtgccctgcatcctcatgaacaacacacagcagctgcgggtgcagctggag
aagatgttcgaggcgatgggtgggaaggagctggacgccgaggccagcggaaccctgaag
gagctgcaggtgaaactcaacaatgtcctggatgaactcagccacgtgtttgccaccagc
ttccagccacacatcgaggagtgtgtcagacaaatgggtgacatcctaagccaagtgaag
ggcacgggcaacgtgcccgccagtgcctgcagcagcgtggcacaggacgcagacaacgtg
ctacagcccatcatggatcttctggacagcaacctcaccctgtttgccaaaatctgtgag
aagacggttctgaagcgggtgctgaaggagctgtggaagctggtgatgaacaccatggag
aggaccattgtcctgccgccactcactgaccagacgatgattggtaccctcttgagaaaa
catggcaagggcctagaaaagggcagggtgaaactgccaagccactcagacgggacacaa
atgatcttcaatgccgccaaggagctgggccagctgtccaaactgaaggatcacatggtg
cgagaagaagccaagagcttgaccccgaagcagtgtgccgtggttgaactggccctggac
accatcaagcaatacttccacgcggggggcgtgggcctcaagaagacctttctcgagaaa
agcccggaccttcagtccctgcgctacgccctgtcgctctacacacaggccaccgacctg
ctcatcaaaaccttcgtgcagacgcagtcagcgcaggtccatggtggaaaggggactagg
tttacccttagtgaagacgtttgtcctgagatgggctcgggtgtggaagaccctgtaggt
gaagtatccgtccacgtggagctgttcacgcatccgggaactggggaacagaaggtcaca
gtgaaggtggtggccgccaacgacctcaagtggcagacttctggcatcttccgtccgttc
attgaggtcaacatcgttggacctcagctcagcgacaagaaacgaaagttcgccaccaaa
tcgaaaaacaacagctgggcgcccaaatataacgagagcttccagttctccctgagcgcc
gacgcgggacccgagtgctacgagttgcaggtgtgcgtgaaggactactgcttcgcgcgc
gaggaccgcacggtggagctggcggtgctgcagctgcgggagctggctcagcgcgggagc
gccgcgtgctggctgccgctcggccgccgcatccacatggacgacacggggctcacagtg
ctgcgtatcctgtcgcagcgcagcaatgacgaggtggccaaggagttcgtcaagctcaag
tccgacacgcgctcggccgaggagggcggtgccgcgcctgcgccctag

DBGET integrated database retrieval system