KEGG   Rattus norvegicus (rat): 65023
Entry
65023             CDS       T01003                                 

Gene name
Kcnip1, Kchip1
Definition
(RefSeq) potassium voltage-gated channel interacting protein 1
  KO
K23855  Kv channel-interacting protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    65023 (Kcnip1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   65023 (Kcnip1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_4 Troponin
Other DBs
NCBI-GeneID: 65023
NCBI-ProteinID: NP_001248318
RGD: 70886
Ensembl: ENSRNOG00000005365
UniProt: Q8R426
Structure
PDB: 
1S6C

Position
10q12
AA seq 227 aa
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDDLEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggggccgtcatgggtaccttctcgtccctgcagaccaaacaaaggcgaccctctaaa
gacatcgcctggtggtattaccagtatcagagagacaagatcgaggatgatctggagatg
accatggtttgccatcggcctgagggactggagcagcttgaggcacagacgaacttcacc
aagagagaactgcaagtcctttaccggggattcaaaaacgagtgccccagtggtgtggtt
aacgaagagacattcaagcagatctacgctcagtttttccctcatggagatgccagcaca
tacgcacattacctcttcaatgccttcgacaccacccagacaggctctgtaaagttcgag
gactttgtgactgctctgtcgattttactgagaggaacggtccatgaaaaactgaggtgg
acgtttaatttgtacgacatcaataaagacggctacataaacaaagaggagatgatggac
atagtgaaagccatctatgacatgatggggaaatacacctatcctgtgctcaaagaggac
actcccaggcagcacgtggacgtcttcttccagaaaatggataaaaataaagatggcatt
gtaacgttagacgaatttctcgagtcctgtcaggaggatgacaacatcatgaggtctcta
cagctgttccaaaatgtcatgtaa

DBGET integrated database retrieval system