KEGG   Rattus norvegicus (rat): 65024Help
Entry
65024             CDS       T01003                                 

Gene name
Chrna9
Definition
(RefSeq) cholinergic receptor nicotinic alpha 9 subunit
  KO
K04810  nicotinic acetylcholine receptor alpha-9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65024 (Chrna9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    65024 (Chrna9)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   65024 (Chrna9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 65024
NCBI-ProteinID: NP_075219
RGD: 621534
Ensembl: ENSRNOG00000002484
UniProt: P43144
Position
14p11
AA seq 479 aa AA seqDB search
MNRPHSCLSFCWMYFAASGIRAVETANGKYAQKLFSDLFEDYSSALRPVEDTDAVLNVTL
QVTLSQIKDMDERNQILTAYLWIRQTWHDAYLTWDRDQYDRLDSIRIPSDLVWRPDIVLY
NKADDESSEPVNTNVVLRYDGLITWDSPAITKSSCVVDVTYFPFDSQQCNLTFGSWTYNG
NQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
IVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG
KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKVVILKYMSRILFVYDVGESCLS
PRHSQEPEQVTKVYSKLPESNLKTSRNKDLSRKKEVRKLLKNDLGYQGGIPQNTDSYCAR
YEALAKNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFAMVFVMTVLIIARAD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggccccattcctgcctctccttttgctggatgtattttgctgcttctggaatc
agagccgtagagacagcaaatgggaaatatgctcagaaattgttcagcgatctttttgaa
gactactccagtgctctgcgtccagtcgaggatacggacgcggtgctgaatgttacactg
caggtcacgctctcccagataaaggacatggacgagagaaaccagattctgacagcctat
ctatggatccgccaaacctggcacgatgcgtacctcacgtgggatcgagaccagtatgat
aggctggactccatcaggattcccagcgatctggtgtggaggccggacattgtcctatac
aacaaggctgacgatgagtcttcagagcctgtgaacaccaatgtggtgctgcgatatgat
gggctcatcacctgggactcaccggccatcaccaaaagctcctgtgtggtggatgtcacc
tacttcccttttgacagccagcagtgcaacctgacctttggctcctggacctacaatgga
aaccaggtggacatattcaatgccctggacagcggtgacctctctgacttcattgaagat
gtggaatgggaggtccatggcatgcctgctgtaaagaacgtcatctcctatggctgctgc
tccgagccttacccagatgtcaccttcactctccttctgaagaggaggtcctccttctac
atcgtcaacctcctcatcccttgcgtcctcatatcgttcctcgctccgttgagtttctat
ctcccagcagcctctggggagaaggtctctctgggagtgaccatcctattggccatgact
gtgtttcagctaatggtggcagagatcatgccagcctcagaaaatgtccctctgatagga
aaatactacatagctaccatggccttgatcactgcctccacagcccttaccatcatggtg
atgaatattcacttctgtggagctgaggcacggccagtgccacactgggccaaggtggtc
atcctgaagtacatgtccaggatcttgtttgtctacgatgtgggtgagagctgccttagt
ccccgccacagccaggagccagaacaagtcacgaaggtttatagcaaactcccagaatcc
aacctgaaaacgtccagaaacaaagacctttccagaaagaaggaagtaagaaaactctta
aagaatgacctggggtaccagggtgggatcccccagaatactgacagttattgtgcacgc
tatgaagcactggcgaaaaatatcgaatacattgccaagtgcctcaaggaccacaaggcc
accaactccaagggcagcgagtggaagaaggtcgccaaagtcatagaccgtttcttcatg
tggattttctttgctatggtgtttgtcatgaccgtcttgatcatagcaagagcagattag

DBGET integrated database retrieval system