KEGG   Rattus norvegicus (rat): 65031
Entry
65031             CDS       T01003                                 

Gene name
Doc2a
Definition
(RefSeq) double C2 domain alpha
  KO
K19916  double C2-like domain-containing protein alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65031 (Doc2a)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   DOC-2 proteins
    65031 (Doc2a)
SSDB
Motif
Pfam: C2
Other DBs
NCBI-GeneID: 65031
NCBI-ProteinID: NP_075226
RGD: 620518
Ensembl: ENSRNOG00000019920
UniProt: P70611
Position
1q36
AA seq 403 aa
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRRGPGPEGGGGGRGFGEAPAHLA
PLALAPPAALLGATTPDDGAEVDSYDSDDTTALGTLEFDLLYDQASCMLHCRILRAKGLK
PMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEELTYSGITDDDITHKVLRI
SVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFNICLERQVPLPSPSSMSAALRGISCYLK
ELEQAEQGPGLLEERGRILLSLSYSSRRHGLLVGIVRCAHLAAMDVNGYSDPYVKTYLRP
DVDKKSKHKTCVKKKTLNPEFNEEFFYEMELSTLATKTLEVTVWDYDIGKSNDFIGGVSL
GPGARGEAQKHWRDCLHQPDTAVERWHTLTSELPPAAGALPLA
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaggggccgcaggggcgatcgcatgaccatcaacatccaggagcacatggccatcaac
gtgtgccctggacccatcaggcccatccgccagatctccgactacttccctcgcaggggg
ccaggaccagagggtggcggcggcggcaggggcttcggggaagccccagctcatctggcc
cctctggctctggccccccctgcggctctccttggggccactacacccgacgatggagct
gaggtagacagctacgactcggatgataccactgccctgggcacgctggaatttgacctt
ctctatgatcaggcttcctgcatgctgcactgtagaatcctcagggccaagggcctcaag
cccatggatttcaacggcctggctgacccctatgtaaagctgcacctcctgccaggagcc
tgcaaggccaataagctaaaaaccaagacacagaggaacacactgaacccagtgtggaac
gaggagctgacgtacagtggaatcacagatgacgacatcacccacaaggtgctcaggatc
tcggtctgtgatgaggacaagctgagtcacaatgaatttattggggagatccgagtgccc
ctccgccgcctcaagccttcacagaagaagcattttaacatctgccttgagcgtcaggtc
ccgcttccttcgccctcttcaatgtctgcggcgctgaggggcatatcctgttacctgaag
gagctagagcaggcagagcagggacctgggctgttggaagagcgcgggcgcatcctgctg
agcctcagctacagctctcggcggcatgggctgctggtgggcattgttcgctgtgctcac
ctggctgcaatggatgttaacggctactctgacccttatgtgaagacgtacttgagacca
gacgtggataagaaatccaagcataagacgtgtgtaaagaagaagacgctgaacccggaa
tttaatgaggaattcttttatgagatggaactctccactctggctaccaagaccctggaa
gtcacagtctgggactacgacattggcaaatccaatgacttcataggtggtgtgtctctg
gggccaggagcccggggagaggcccagaaacactggagagactgtctacatcagccggac
acagcagtggagcgctggcataccctgaccagcgagctgcccccagcagcaggggcgttg
ccgttggcctga

DBGET integrated database retrieval system