KEGG   Rattus norvegicus (rat): 65036Help
Entry
65036             CDS       T01003                                 

Gene name
Bche
Definition
(RefSeq) butyrylcholinesterase
  KO
K01050  cholinesterase [EC:3.1.1.8]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    65036 (Bche)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.8  cholinesterase
     65036 (Bche)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 65036
NCBI-ProteinID: NP_075231
RGD: 619996
Ensembl: ENSRNOG00000009826
UniProt: Q9JKC1
Position
2q32
AA seq 597 aa AA seqDB search
MVTEIHFLLWILLLCMLFGKSHTEEDVIITTKTGRVRGLSMPILGGTVTAFLGIPYAQPP
LGSLRFKKPQPLNKWPDVYNATKYANSCYQNIDQAFPGFQGSEMWNPNTNLSEDCLYLNV
WIPVPKPKNATVMVWVYGGGFQTGTSSLPVYDGKFLTRVERVIVVSMNYRVGALGFLAFP
GNSEAPGNMGLFDQQLALQWIQRNIAAFGGNPKSVTLFGESAGAASVSLHLLCPQSYPLF
TRAILESGSSNAPWAVKHPEEARNRTLTLAKFIGCSKENEKEIITCLRSKDPQEILLNEK
LVLPSDSIRSINFGPTVDGDFLTDMPHTLLQLGKVKTAQILVGVNKDEGTAFLVYGAPGF
SKDNDSLITRREFQEGLNMYFPGVSSLGKEAILFYYVDWLGDQTPEVYREAFDDIIGDYN
IICPALEFTKKFAELEINAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYT
RAEEIFSRSIMKTWANFAKYGHPNGTQGNSTVWPVFTSTEQKYLTLNTEKSKINSKLRAP
QCQFWRLFFPKVLEITGDIDEREQEWKAGFHRWSNYMMDWKNQFNDYTSKKETCTDL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggtcacagaaattcacttcctcctatggattcttctgctctgcatgctttttgggaag
tcacacactgaagaagacgtcataattacaaccaagactggaagagtccgagggctgagc
atgcccattctaggtggcacagtgactgcctttctcggtatcccctatgcacagcctcct
ctgggtagcctaagattcaaaaagccacaacctttaaacaaatggcctgatgtctataat
gccactaaatatgcaaattcttgttatcagaatatagatcaagccttcccaggcttccag
gggtcagaaatgtggaatccaaacacgaacctcagtgaagactgcttgtatctgaatgtt
tggattccagtacctaagcccaagaatgcgactgtcatggtgtgggtctatggtggtggc
tttcaaactgggacctcctctctacccgtttatgatgggaaatttctcactcgtgttgaa
agagttattgtagtttcaatgaactatagggtaggtgccctaggattcctagcttttcca
ggaaattctgaggctccaggaaacatgggtttatttgatcaacagttggcacttcagtgg
atccaaagaaatatagctgctttcggagggaatcctaaaagtgtaacactttttggagaa
agtgcaggagctgcttcagttagcttacatttgctatgtccccaaagttaccctttgttt
actagagccattctagaaagtggctcctctaatgccccctgggcagtaaagcatccagag
gaagccagaaacagaaccttaaccttagctaaatttattggttgctcaaaggagaatgag
aaggagataattacatgccttcgaagtaaagatcctcaggaaattcttctgaatgaaaag
ttagttctcccctctgattccatcagatcgattaattttggtccaacagtggatggcgat
tttctcactgatatgccccacacactactccaacttggaaaagtgaaaacagctcagatc
ttagtgggcgttaacaaggatgaagggacagctttcctagtgtacggtgctcctggtttc
agcaaagacaatgatagtcttatcacacggagggaatttcaagaaggtttaaatatgtat
ttccctggagtgagcagcttgggaaaggaagcaatccttttctactatgtggactggtta
ggtgaccagacaccggaagtctaccgtgaagctttcgatgatattattggagattacaac
atcatatgccctgcactggagtttaccaagaaatttgcagaactagaaattaatgccttt
ttctactattttgaacaccgatcttccaaactaccttggccagaatggatgggagtaatg
catggctatgaaattgaatttgtatttggcttacccctggaaagaagagttaattacaca
agggctgaggaaatctttagtcgatccataatgaaaacttgggcaaattttgcaaaatat
ggacatcccaatgggactcagggcaatagcacagtgtggcctgtcttcacaagtactgaa
caaaaatacctaaccttgaacacagagaagtcaaaaataaactctaaactccgggctccc
cagtgccaattctggagactattttttccaaaagtcttggaaataacaggagatattgat
gaaagggagcaagagtggaaggcaggattccatcgctggagcaattacatgatggactgg
aaaaatcaatttaacgattacactagcaagaaagagacttgtacagatctctaa

DBGET integrated database retrieval system