KEGG   Rattus norvegicus (rat): 65037Help
Entry
65037             CDS       T01003                                 

Gene name
Mertk, rdy
Definition
(RefSeq) MER proto-oncogene, tyrosine kinase
  KO
K05117  c-mer proto-oncogene tyrosine kinase [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    65037 (Mertk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     65037 (Mertk)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   65037 (Mertk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase fn3 Ig_3 Ig_2 I-set ig V-set C1-set Ig_6 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 65037
NCBI-ProteinID: NP_075232
RGD: 69283
Ensembl: ENSRNOG00000017319
UniProt: P57097
Position
3q36
AA seq 994 aa AA seqDB search
MVLAPLLLGLLLLSALWNGGTAEKEEEIKPDQPFSGPLPGSLPADHRPFFAPHSSGDQLS
PSQTGRSHPAHTATPQMTSAASNLLPPVAFKNTIGRIVLSEHKSVKFNCSINIPNVYQET
AGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSITSVQRSDNGSYICKMKVNDREVV
SDPIYVEVQGLPYFTKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNENPERS
PSVLTVAGLTETAVFSCEAHNDKGLTVSKGVQINIKVIPSPPTEVHILNSTAHSILVSWV
PGFDGYSPLQNCSIQVKEADQLSNGSVMVFNTSASPHLYEVQQLQALANYSVTVSCRNEI
GWSAVSPWILASTTEGAPAVAPLNITVFLNESSNNLEIRWTKPPIKRQDGELVGYRISHV
WESAGTSKELSEEVSQNGSWAQVPVQMHNATCTVRIAVITKGGIGPFSEPVDVAIPEHSR
VDYAPSSTPAPGNTESMLIILGCFCGFVLMGLILYLSLAIKRRVQETKFGGAFSEEDSQL
VVNYRAKKSFCRRAIELTLQSLGVSEELQNKLEDVVVDRNLLILGKVLGEGEFGSVMEGN
LKQEDGTSQKVAVKTMKLDNFSLREIEEFLSEAACMKDFNHPNVIRLLGVCIELSSQGIP
KPMVILPFMKYGDLHTFLLYSRIESVPKSIPLQTLLKFMVDIAQGMEYLSSRNFLHRDLA
ARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWA
FGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDDLYEIMYSCWSADPLDRP
TFSVLRLQLEKLSESLPDAQDKESIIYINTQLLESCEGLANRSSLAGLDMNIDPDSIIAS
CTAGAAVSVVMAEVHENNLHEERYILNGGNEEWEDVASTPFATVTAGKDGVLPEDRLTKN
GISWSHHSTLPLGSPSPDELLFADDSSGDSEVLM
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggttctggccccactactgctggggctgctgctgctatccgcactctggaatggaggc
actgctgaaaaggaggaagaaatcaagccagatcagccattttcagggcctttaccaggg
agcctaccagctgaccacaggccattcttcgcccctcactccagtggggaccagctgtca
ccatcccagactggaagatcacatccagcacacacagccactccccagatgacctctgca
gcatcaaacctcctgcctcctgttgcatttaaaaacacaattggacgcatagtactttcg
gaacataaaagtgtcaaatttaattgctcgatcaacattcctaacgtgtatcaagaaaca
gctggcatttcgtggtggaaagatggaaaggaactgcttggggcacatcattcaatcaca
cagttttatcctgatgaggaaggggtatcaataattgcattgttcagcataaccagtgtg
cagcgctcagacaatgggtcgtacatctgtaagatgaaggtgaacgatagagaggttgtg
tctgatcccatatacgtggaagtccaaggactcccttactttactaagcagcctgagagc
gtgaatgtcaccagaaacacagccttcaacctcacctgccaggctgtgggaccccctgag
cccgtcaacatcttctgggttcaaaatagcagccgtgttaatgaaaatccagaaaggtcc
ccgtctgtcctaactgtcgctggtctgacagagaccgcagtcttcagctgtgaggcccac
aacgacaaaggactgacggtgtccaagggtgtacagatcaacatcaaagtcatcccttcc
ccacccactgaagtccatatcctcaacagcacagcgcacagcatcctggtctcctgggtc
ccagggtttgatggctactccccacttcagaactgcagcattcaggtcaaggaagctgac
cagctgagtaatggctcagtcatggtttttaatacctctgcttcgccacatctgtatgaa
gtccagcagctgcaagccctggctaattacagcgtcactgtgtcctgtcggaatgagatt
ggctggtctgcagtgagcccttggatcctggccagcactacagaaggagctccagcagtg
gcgcctctaaacatcactgtgtttctgaacgaatccagcaacaacctggaaatcagatgg
acgaagcctccaattaagcggcaggatggggaactggtgggctaccggatatctcacgtg
tgggagagtgcggggacttccaaagagctttctgaagaagtcagccagaatggcagctgg
gctcaggttcctgtccaaatgcacaatgccacctgcacagtgagaatcgccgtcatcact
aaagggggcattgggcccttcagtgagccagtggacgtagccattccggagcacagtagg
gtagattacgcaccctcatcaaccccagcccctggcaacaccgagtctatgctcatcatc
ctgggctgcttctgcgggtttgttctcatggggttgattctgtatctttctctggccatc
aaaaggagagtccaggaaacaaagtttgggggtgcattctccgaggaggactcccaatta
gttgtaaattacagagcaaagaagtccttctgtcggcgagccatcgagcttaccttgcaa
agcctgggggtgagcgaggagctgcaaaacaagctagaagatgttgtggttgacagaaat
cttctaattcttgggaaagttctgggcgaaggagagtttgggtctgtaatggaaggaaat
ctgaagcaggaagatgggacttctcagaaggtggcagtgaagaccatgaagttggacaac
ttttctctacgggagatcgaggagtttctcagcgaagcagcgtgcatgaaagacttcaat
cacccaaacgtcatccggcttctaggcgtgtgtatagaactgagctctcaaggcatcccg
aagcccatggtgattttacccttcatgaaatacggagacctccacaccttcctgctatat
tcccggatagaatcagtaccgaagtccatccccctgcagacactgctgaagttcatggtg
gacattgcccagggaatggagtacctgagcagcaggaattttctccacagggatttagct
gctcggaattgcatgttgcgggatgacatgactgtctgcgtggcagactttggcctctct
aagaagatttacagtggtgattattaccgccaaggccgcattgccaaaatgcctgtgaag
tggatcgccatagagagcctggcggaccgagtctacacaagcaagagtgacgtgtgggct
tttggcgtgaccatgtgggaaatagcaacacggggaatgactccctatcctggagtccag
aaccatgagatgtacgattaccttctccacggccacaggctgaagcagcccgaggactgc
ctggatgatctgtatgaaatcatgtactcttgctggagtgctgatcccctggaccgaccc
accttctcagtgctgaggctgcagctggaaaagctctccgagagtttgcctgatgcccag
gacaaagaatccatcatctacatcaatacacagttactagagagctgcgagggcctagcc
aacaggtcctccctcgcagggctagacatgaacattgatcctgactccatcattgcctct
tgcacagcaggtgctgctgtcagcgtggtcatggcggaagttcacgagaacaaccttcat
gaggaaagatacatcttaaatgggggcaacgaggaatgggaagatgtggcctccactcca
tttgctacagtcacagctggaaaagatggtgtgttaccagaggacagactcaccaaaaat
ggcatctcctggtctcaccatagtacgctacccttggggagcccatcaccagatgaactt
ctgtttgcagacgactcctcgggagactctgaagttctgatgtga

DBGET integrated database retrieval system