KEGG   Rattus norvegicus (rat): 65038Help
Entry
65038             CDS       T01003                                 

Gene name
Inppl1, Ship2
Definition
(RefSeq) inositol polyphosphate phosphatase-like 1
  KO
K15909  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 [EC:3.1.3.86]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04662  B cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    65038 (Inppl1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    65038 (Inppl1)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    65038 (Inppl1)
   04666 Fc gamma R-mediated phagocytosis
    65038 (Inppl1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    65038 (Inppl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65038 (Inppl1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     65038 (Inppl1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    65038 (Inppl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 Exo_endo_phos SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 65038
NCBI-ProteinID: NP_075233
RGD: 68396
Ensembl: ENSRNOG00000019730
Vega: OTTRNOG00000002267
UniProt: Q9WVR3
Position
1q32
AA seq 1257 aa AA seqDB search
MASVCGAPSPGGALGSQAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCV
LYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEGE
REPDPPDDRDASDVEDEKPPLPPRSGSTSISVPAGPSSPLPAPETPTTPAAESTPNGLST
VSHEYLKGSYGLDLEAVRGGASNLPHLTRTLVTSCRRLHSEVDKVLSGLEILSKVFDQQS
SPMVTRLLQQQSLPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPPAPLQP
SIRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTF
THDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNKHSKQD
EPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKALDEVTVTIPHDIYVFGTQENSVGDR
EWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLG
NKGAVGVSFMFNGTSFGFVNCHLTSGNEKTTRRNQNYLDILRLLSLGDRQLSAFDISLRF
THLFWFGDLNYRLDMDIQEILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEEISFPP
TYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHS
PVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKK
SFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVV
ALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDDTGAK
SKAPSVLRGSQEHRSGSRKPTSTEASCPLSKLFEEPEKPPPTGRPPAPPRAVPREESLNP
RLKSEGTPEQEGVAAPPPKNSFNNPAYYVLEGVPHQLLPLEPTSFARAPIPPTTKNKVAI
TVPAPQLGRHRTPRVGEGSSSDEDSGGTLPPPDFPPPPLPDSAIFLPPNLDPLSMPVVRG
RSVGEARGPPPPKAHPRPPLPPGTSPASTFLEEVASADDRSCSVLQMAKTLSEVDYSPGP
GRSALLPNPLELQLPRGPSDYGRPLSFPPPRIRESIQEDLAEEAPCPQGGRASGLGEAGM
GAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagtgtgtggggcaccgagtcccgggggcgcgctaggcagccaggcccctgcc
tggtatcaccgtgacctgagccgcgcggctgcggaggagctgctagctcgggcaggccgc
gatggcagcttcctggtgcgagacagcgagagcgtggcgggggccttcgcactctgcgtc
ctgtatcaaaagcacgtgcacacctaccgcattctgccagatggagaggatttcctggct
gtgcagacctcacagggcgttcctgtgcgccgcttccagaccctgggtgagcttataggc
ctgtatgcccagcccaaccagggtcttgtctgtgctctgctgctgcctgtagagggggag
agagagccagatccaccggatgaccgagatgcctcagatgtggaggacgagaaaccccca
ctacccccgcgctctggctctaccagcatttctgtccctgcggggcctagcagccccctg
ccagcccctgagactcccacaactccagcagctgagagcactcctaatggactcagcact
gtgtcacatgagtatctgaagggcagctacgggctggacctggaggctgtacgaggcgga
gccagcaacttgccccatctcacccgaacccttgtcacctcatgccgtaggctacacagc
gaggtggacaaggtcctgtcaggcctagagatcctgtcgaaggtgtttgaccagcagagc
tcacccatggtgacccgccttttgcagcagcagagcctaccacagactggagagcaagag
ttggagagccttgtgctgaagctatctgtgctaaaggacttcctgtcaggcatccagaag
aaggccctaaaggcactgcaggacatgagctccacagcacctccggctccattgcagccc
tccatacgaaaggccaagaccatccctgtgcaagcctttgaggtgaagctggatgtgaca
ctgggtgacctgaccaagatcgggaagtcccagaagttcacactgagcgtggatgtggag
ggtgggaggctggtactgctgaggagacagcgtgactcccaggaggactggacgaccttc
acacacgaccggatccggcagctcattaaatcccagcgtgtgcagaacaagctgggtgtt
gtgtttgaaaaggagaaagatcggacgcagcgcaaggacttcatctttgtcagtgcccgg
aagcgagaagccttctgccagcttctgcagctcatgaagaacaagcattccaagcaggat
gaacctgacatgatctccgtcttcataggcacctggaacatgggaagtgtaccaccacca
aaaaacgtgacatcttggttcacatcaaagggactggggaaagccctggatgaggtcaca
gtgactataccccacgatatctatgtctttgggactcaggagaactcagtgggtgacaga
gagtggctggatctgctgcgtgggggcctcaaggagcttacagatctggattaccgtccg
attgctatgcagtcactgtggaacatcaaggtggccgtgctggtcaagccagaacatgag
aaccgcatcagccacgttagtacgtccagtgtgaagactggtatcgccaataccctgggg
aacaagggagctgtgggtgtttccttcatgttcaatggcacttcttttggcttcgtgaat
tgccatctcacctcagggaatgagaagactactcggcggaaccagaattatctggacatc
ctgcgtcttctctcattgggtgatcggcagctcagtgcctttgacatctctttgaggttc
actcatctcttctggtttggggaccttaactaccgcttagacatggatatccaggagatc
ctgaactacattagtaggagagagtttgagcccctgctcagggtggaccagctcaacctg
gagcgggagaagcataaggtcttccttcgatttagtgaggaggagatatctttcccaccc
acctaccgctacgagcggggttcccgagacacatatgcttggcacaagcagaagccaact
ggggtccggaccaatgtgccttcatggtgtgaccggattctatggaaatcctatcctgaa
acccacatcatctgcaattcctatggttgcactgatgacattgttaccagtgaccattct
cctgtgtttgggacatttgaggttggagtgacttcccagttcatctccaagaaaggtctc
tctaagacctcagaccaggcctacattgagtttgagagcatcgaggccatcgtgaagacg
gccagccgcaccaagttcttcattgagttctattctacctgcttggaagagtacaagaag
agcttcgagaatgacgctcagagcagtgacaacatcaatttcctcaaggtgcagtggtcc
tcgcgccagctgcccacgctcaagccaattctggctgacattgagtacctgcaggatcag
catctcctgctcacagtcaagtccatggatggctacgaatcatatggggagtgtgtggtt
gcactcaaatccatgattggcagcacggcccagcagttcttgaccttcttgtcccaccgt
ggagaggagacaggcaacattcgtggctccatgaaggtgcgggtgcccacagaacgcctg
ggcacccgtgagcggctctatgaatggattagcattgataaggatgacacaggagccaaa
agcaaggctccttcagtgttgcggggcagccaggagcacagatctgggagccgcaagcca
acttccacagaggcctcctgtccactgtccaagttgtttgaagagcctgaaaagccacca
ccgactggcaggcccccagccccaccacgggcagttcctagggaggagtccttgaacccc
aggttgaagtcagaggggacacctgaacaggaaggagtagcagcccctccacccaagaac
agcttcaataaccctgcctactacgtccttgaaggggtcccacatcagctgctgcccctg
gagccaacctcatttgccagggcccctatcccacctaccaccaagaacaaagtggccatc
acagtgcctgctcctcagcttgggcgccaccggacccctcgtgtgggggagggaagctct
tcggatgaggactctgggggcacactgcctcctccagacttcccacctccaccactgcca
gactcagccatcttcctgccccctaacctggatcctttatcaatgccagtggtcaggggc
cgaagtgtgggtgaggcccgtggcccaccacctcccaaggcccatccaagaccaccacta
ccgccgggcacctcacctgccagtacttttttggaagaggttgcaagtgcggatgaccgg
tcttgctcagtactgcagatggccaagacactcagtgaggtagattattctcctgggcct
ggacgctcagcactcctccccaaccccttggaattgcagcttccccgagggccctcggac
tacggacgacccctcagcttccctccaccccgcatccgggagagcatccaagaagacttg
gcagaggaggctccgtgcccgcagggcgggcgggccagcgggctgggagaggcgggcatg
ggtgcctggctgcgggccatcggcttggagcgctatgaggagggcctggtgcacaatggc
tgggacgacctggagtttctcagtgacatcactgaggaagacctcgaggaagctggggtg
caggatcctgctcacaagcgccttcttctggacacgctgcagctcagcaagtga

DBGET integrated database retrieval system