KEGG   Rattus norvegicus (rat): 65046Help
Entry
65046             CDS       T01003                                 

Gene name
Ap2s1, Ap17
Definition
(RefSeq) adaptor-related protein complex 2, sigma 1 subunit
  KO
K11827  AP-2 complex subunit sigma-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    65046 (Ap2s1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    65046 (Ap2s1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    65046 (Ap2s1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    65046 (Ap2s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65046 (Ap2s1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    65046 (Ap2s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s Recep_L_domain
Motif
Other DBs
NCBI-GeneID: 65046
NCBI-ProteinID: NP_075241
RGD: 620188
Ensembl: ENSRNOG00000015865
UniProt: P62744
Structure
PDB: 

Position
1q21
AA seq 142 aa AA seqDB search
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatccgattcattctcatccagaaccgggcaggcaagacacgcctggccaagtggtat
atgcagttcgatgatgacgagaagcagaagttgatcgaggaagtgcacgccgtggtcacc
gtcagggatgccaagcacaccaactttgtggagttccggaacttcaagatcatctaccgg
cgctacgctggcctctacttctgcatctgcgttgacgtcaacgacaacaatctggcctat
cttgaggccatccacaacttcgtagaagtgttaaatgaatacttccacaatgtctgtgaa
ctggacctggtgttcaacttctacaaggtttacacggtggtagatgagatgttcctggca
ggagagatccgagagacgagccagacgaaggtgctgaagcagctgctgatgctgcagtcg
ctggagtga

DBGET integrated database retrieval system