KEGG   Rattus norvegicus (rat): 65051
Entry
65051             CDS       T01003                                 

Gene name
Serpina5
Definition
(RefSeq) plasma serine protease inhibitor isoform 1
  KO
K03913  protein C inhibitor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    65051 (Serpina5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    65051 (Serpina5)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    65051 (Serpina5)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   65051 (Serpina5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   65051 (Serpina5)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 65051
NCBI-ProteinID: NP_001231668
RGD: 619817
Ensembl: ENSRNOG00000009855
UniProt: Q66HL5 F7EMJ6
Position
6
AA seq 442 aa
MTFASYNSLCPLSSHKPGGLLPIKTLSHHNTEMAATMRFFPILCLVLFFSHGVASRQRSH
SKEKKKSKESSVGAVGTSRSRDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGL
KTKAQILEGLGLSLQQGQEDMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHF
LSAMKTLYMSDMFSTNFGNPESAKKQINDYVAKKTNGKIVDLIKDLDSTHVMVVVNYIFF
KAKWQTAFSSTNTHKMDYHVTPKKTIQVPMMNREDIYSYILDQNISCTVVGIPYQGNTFA
LFILPSEGKMKRVEDGLDERTLRNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQD
IFTTHADLSGLTDHTNIKLSEMVHKSMVEVDESGTTAAASTGILFTLRSARPSSLKVEFT
RPFLVVIMDGTNLYFIGKVIQP
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgacatttgccagctataattcactctgtcctctctcttctcataagccaggtggattg
ctacccatcaagacactcagccaccacaatacagaaatggcagccacaatgaggttcttc
cccattctgtgcctggtgctgttcttcagtcacggggtggcttcccgccaacgctcccat
tctaaggagaagaagaagtctaaagagtcctctgtgggtgctgtggggacttcccgaagc
agagactttgccttcaggctctacagggccttggcttctgaagcccctggtcagaatgtt
ttcttctcccccatgagcgtgtctatgagcttgggtatgctctccctggggtcaggcttg
aagactaaggcacagatcctggagggcctgggcctcagcctccagcaaggccaagaggat
atgctccacaagggcttccaacagctgctgcagcagttcagccagcctagtgatggcctc
cagctgagcctaggcagtgccctttttacagacccagcagtacatatccgggaccacttt
ctgagtgccatgaagacattgtacatgtcagacatgttctctaccaactttgggaaccct
gaaagtgctaagaagcagatcaatgactatgtagccaagaagaccaacggcaagattgta
gacttgatcaaggatcttgacagcacccacgtcatggtggtggtaaattatatcttcttc
aaagccaagtggcagacggccttcagtagcaccaacacccacaagatggattaccatgtg
actcccaagaagaccattcaggtgccaatgatgaaccgcgaagatatatattcctacatc
ctcgaccaaaacatttcctgcacggtggtggggatcccttaccaaggcaatacatttgct
ctgtttattcttcccagcgagggcaagatgaagcgggtagaggatggcctggatgagaga
acgttgaggaactggcttaagatgttcacaaagagacagttagatctttacctccccaag
ttctccattgagggtacctataaactggaaaaaatcctccccaagctgggcatccaggac
atcttcaccacccatgctgacttgtctggccttactgaccacaccaatattaagttgtct
gagatggtacacaaatccatggtggaggtagacgagtcaggaacaacagcagctgcctcc
acaggaattctcttcacactcagatctgctcgaccgagctctctgaaggtagaattcacc
agaccctttctggtggtcattatggatggtacaaacctctatttcattggcaaagtgatt
cagccctga

DBGET integrated database retrieval system