KEGG   Rattus norvegicus (rat): 65052
Entry
65052             CDS       T01003                                 

Gene name
Pik3c3
Definition
(RefSeq) phosphatidylinositol 3-kinase, catalytic subunit type 3
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04145  Phagosome
rno04371  Apelin signaling pathway
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05132  Salmonella infection
rno05152  Tuberculosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    65052 (Pik3c3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    65052 (Pik3c3)
   04070 Phosphatidylinositol signaling system
    65052 (Pik3c3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    65052 (Pik3c3)
   04140 Autophagy - animal
    65052 (Pik3c3)
   04136 Autophagy - other
    65052 (Pik3c3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    65052 (Pik3c3)
   05016 Huntington disease
    65052 (Pik3c3)
   05017 Spinocerebellar ataxia
    65052 (Pik3c3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    65052 (Pik3c3)
   05152 Tuberculosis
    65052 (Pik3c3)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    65052 (Pik3c3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65052 (Pik3c3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     65052 (Pik3c3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Macropinocytosis
   Kinases
    65052 (Pik3c3)
  Rab GTPases and associated proteins
   Rab associated proteins
    65052 (Pik3c3)
 Endosome - Lysosome transport
    65052 (Pik3c3)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    65052 (Pik3c3)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 HEAT_2
Other DBs
NCBI-GeneID: 65052
NCBI-ProteinID: NP_075247
RGD: 620899
Ensembl: ENSRNOG00000017840
UniProt: O88763
Position
18p12
AA seq 887 aa
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKPFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGRAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQASVSESLSSSGVSSADIDSSQIITNPLPPVASPPPASKSKEVSDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgggggaggcggagaagttccactacatctacagctgtgacctggacatcaacgtgcag
ctgaagatagggagcttggaagggaagagagaacaaaagagctacaaagctgtcctagaa
gatcccatgctaaagttttccggactataccaagagacatgctctgatctgtatgtgact
tgtcaagtttttgctgaagggaagcccctggccttgccagtcagaacatcctacaaacca
tttagtacacgatggaattggaacgagtggctgaaactcccggtgaaataccctgacctg
cccaggaacgcccaagtggccttgactatatgggatgtgtatggacccggaagggctgtg
ccggtgggaggaacaaccgtgtcactctttggaaaatatggcatgtttcgccaaggaatg
cacgacttgaaagtctggcctaacgtggaggcagatggctccgaacccacacgaaccccg
ggcagaacaagcagcacactctcagaagaccagatgagccgccttgccaagcttaccaag
gctcatcggcagggacacatggtgaaggtggattggttggacagactaacgtttagagag
atagaaatgataaatgagagtgagaaacgaagctctaatttcatgtacttgatggttgag
tttcgctgtgtcaaatgcgatgacaaggaatatggtattgtctactatgaaaaggatggt
gacgaatcatctccaattttaacaagctttgagttagtgaaagttcctgatcctcaaatg
tctatggagaacttagtggagagcaaacaccacaagcttgctcggagtttaagaagtgga
ccatctgaccacgatctcaaacccaacgctaccacaagagatcagctaaatattattgtg
agctacccaccaaccaagcagctcacatatgaagaacaagatcttgtttggaaatttaga
tattatcttactaatcaagaaaaggctctgacaaagttcttgaagtgtgttaactgggac
ctaccccaggaggccaagcaggcgctggaacttctgggaaagtggaagccaatggatgtg
gaggattccctagagctgctctcctctcattacaccaaccccaccgtgcggcggtacgct
gtggcccgcttgaggcaggccgatgacgaggatttgctgatgtacttgctgcagctggtc
caggctctgaaatatgaaaactttgatgacataaagaacggtttggagcctaccaagaag
gatagtcaagcttccgtgtcagagagcctgtcaagttctggagtcagttctgcagatata
gatagctctcaaattataaccaaccctcttcctccggtggcctcccctcctcctgcatct
aaatcaaaggaagtttctgatggggaaaacctagagcaggatctttgtaccttcttgata
tcaagagcctgtaagaactcaacactggctaactatttatactggtatgtgatagtggag
tgcgaagatcaggacacacagcagagggacccaaagactcacgagatgtacctgaacgtc
atgaggcgcttcagccaagccctgctcaagggtgacaagtccgtgcgggtcatgcgctcc
ctgctggcggcacagcagacctttgtagatcgcctggtgcatctgatgaaggcagtgcag
agagaaagtgggaaccgcaagaagaagaatgagagacttcaagccttgcttggagataat
gaaaaaatgaacttatcagatgtggagctgatcccattgccgttagagccacaggtgaaa
atacggggaatcatcccggaaacagccacactgttcaagagtgctcttatgcctgcccag
ctgttcttcaagacagaagacggtggcaaataccctgtgatcttcaagcatggggacgac
ttgcgtcaagatcagcttatccttcagatcatctccctcatggacaagctgttgcggaaa
gaaaatctggatttgaaattgaccccttacaaggtgttagccacgagtacaaaacatggc
ttcatgcagttcatccagtcagttcccgtcgccgaagttcttgacacggagggaagcatt
cagaactttttcaggaaatatgccccaagcgagactggacccaatggcatcagtgcagag
gtcatggacacttacgttaagagctgtgctggctactgtgtgatcacctacatccttggg
gttggagaccggcacctggataaccttctgttaacaaagacaggcaaactcttccatata
gatttcgggtatattctgggccgagatcccaagcctcttcctcctccaatgaagctgaat
aaggagatggtcgaagggatgggtggtacccagagtgagcagtaccaagagttcagaaag
cagtgttacacggccttcctccacctgcgaaggtattcaaatctgattctgaacttgttc
tccttgatggttgatgcaaacattccagatattgctcttgaaccagataaaactgtaaaa
aaggttcaggataagttccgtctggacctgtcagatgaggaggccgtgcattacatgcag
agtctgatcgacgaaagtgttcacgccctgttcgctgcggtggtggagcagatccataag
tttgcccagtactggagaaaatga

DBGET integrated database retrieval system