KEGG   Rattus norvegicus (rat): 65081Help
Entry
65081             CDS       T01003                                 

Gene name
Vps33a, r-Vps33a
Definition
(RefSeq) VPS33A CORVET/HOPS core subunit
  KO
K20182  vacuolar protein sorting-associated protein 33A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65081 (Vps33a)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    65081 (Vps33a)
   Hops complex
    65081 (Vps33a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec1 Pectinesterase DUF1629
Motif
Other DBs
NCBI-GeneID: 65081
NCBI-ProteinID: NP_075250
RGD: 620643
Ensembl: ENSRNOG00000056889
UniProt: Q3KRF0
Position
12q16
AA seq 597 aa AA seqDB search
MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEV
EKMFTLKGSRLPAADVKNIIFLVRPRLELMDMIAENVLSEDRRGPTRDFHILFVPRRSLL
CEQRLKDLGVLGSFIYREEYSLDLIPFDGDLLSMESESAFKECYLEGDQTSLYHAAKGLM
TLQALYGTIPQIFGKGECARQVANMMVRMKREFTGSQNSVFPVFDNLLLLDRNVDLLTPL
ASQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGGGGGKDLPTEAKKLQLNSAEELYAEI
RDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAE
LIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHPLIKVLRLVCLQSVCNSG
LKQKVLDYYKREILQTYGYEHILTLNNLEKAGLLKAQTGGRNNYPTIRKTLRLWMDDVNE
QNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQP
GENRVTLVFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLINGSSWLEALMEKPF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcacctgtcatacgggcgagtgaacctgaacgtgctgcgcgaggcggtgcgt
cgggagctgcgcgagtttctggacaagtgcgctgggagcaaggcaatagtgtgggatgaa
tacttaacaggaccgtttggactgattgcacagtactcactactaaaggaacatgaagtg
gaaaaaatgttcaccctcaaaggaagtcgtttgccagcggctgatgtcaagaatatcatt
tttttggtcagacccaggctagaattaatggatatgattgccgagaacgtactcagtgag
gacaggcgtggccctaccagggatttccatattttgtttgtgcctcgtcggagcctactg
tgtgagcaaaggctgaaggacctgggtgtgttgggatcctttatttatcgagaggagtac
agtttagatctcattccatttgatggggacctcttatccatggagtcagagagcgctttc
aaagaatgctaccttgaaggcgaccagacaagcctgtaccacgcagccaaggggctgatg
accctgcaggcgctgtatggaactatcccccagatctttgggaaaggagagtgtgctcgg
caagtggccaatatgatggtcaggatgaaaagggagtttacaggcagccaaaactcagtg
ttccccgtgtttgataacctcttactgcttgatcgcaacgtggatctgctgacgccgctc
gcctcccagctcacgtacgaaggactcatcgacgagatttacggcattcagaacagttat
gtgaagttacctccagagaaatttgcacccaagaagcagggcggtggtggcgggaaggac
cttcccacagaggcaaagaagcttcagctcaactccgcagaggaactctatgccgagatc
cgagacaagaacttcaacgctgtgggctccgtgctcagcaagaaggcgaagatcatctcc
gcggcctttgaggagcgacacaatgctaagacggttggagagatcaagcaattcgtctcc
cagcttccccacatgcaggcggccagggggtcgcttgccaaccacacctcaattgcagag
ttaatcaaagacgtcaccacttctgaagacttctttgataagttgacggtggagcaggag
ttcatgtccgggatagacaccgataaggtcaacaattacatcgaggactgcattgcccaa
aagcacccgctcatcaaggtcctgagattggtttgcctccagtctgtgtgcaacagtggg
ctcaagcagaaggttctggactactacaaaagggaaattctccagacctacggctatgag
cacatactgaccctgaacaacctggagaaggccggcctgctaaaggctcagacagggggc
agaaacaactacccaacgattcggaaaacattacgcctctggatggacgatgtcaatgaa
caaaaccccacagacatatcctacgtgtacagtggttacgcaccactcagcgtgcgactc
gcccagctcctttctcggccaggttggaggagcatcgaggaggttctccgcattctccca
gggccccactttgaagaaaggcagccactgcccaccgggctgcagaagaaacgccagcca
ggagaaaacagagtcacactggtgtttttcctcgggggcgtcacctttgctgaaatcgca
gccctgcgttttctctcccagctggaagacggaggcacagagtatgtaattgcgaccact
aaactgataaatggaagcagctggctagaagctctcatggaaaagcctttctag

DBGET integrated database retrieval system