KEGG   Rattus norvegicus (rat): 65096Help
Entry
65096             CDS       T01003                                 

Gene name
Adgrl1, CL1BA, Lphn1
Definition
(RefSeq) adhesion G protein-coupled receptor L1
  KO
K04592  adhesion G protein-coupled receptor L1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    65096 (Adgrl1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65096 (Adgrl1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    65096 (Adgrl1)
Peptidases [BR:rno01002]
 Mixed Peptidases
  Family P2
   65096 (Adgrl1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Others
   Others
    65096 (Adgrl1)
G protein-coupled receptors [BR:rno04030]
 Adhesion receptor family
  Latrophilin
   65096 (Adgrl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Latrophilin OLF 7tm_2 GAIN Gal_Lectin GPS HRM Coatomer_g_Cpla
Motif
Other DBs
NCBI-GeneID: 65096
NCBI-ProteinID: NP_075251
RGD: 620768
Ensembl: ENSRNOG00000029134
UniProt: O88917
Structure
PDB: 

Position
19q11
AA seq 1471 aa AA seqDB search
MARLAAALWSLCVTTVLVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVEN
ANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYK
YLEVQYDCVPYKVEQKVFVCPGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWI
PYRTDTLTEYASWEDYVAARHTTTYRLPNRVDGTGFVVYDGAVFYNKERTRNIVKYDLRT
RIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVSQLNPYTL
RFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSL
AFPNPYQFVSSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPT
PLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPAPSTRRPPAPNLHVSPELFC
EPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPALGLWNPRGPDLSNCTSPWVNQV
AQKIKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAG
KNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAF
LLADNVREPARFLAAKQNVVLEVTVLSTEGQVQELVFPQEYASESSIQLSANTIKQNSRN
GVVKVVFILYNNLGLFLSTENATVKLAGEAGTGGPGGASLVVNSQVIAASINKESSRVFL
MDPVIFTVAHLEAKNHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTNF
AVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCI
NLFLAELLFLVGIDKTQYEVACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYS
RTKYYYLGGYCFPALVVGIAAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLVF
LMVTLHKMIRSSSVLKPDSSRLDNIKSWALGAIALLFLLGLTWAFGLLFINKESVVMAYL
FTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPGGAHGSLKTSAMRSNTRY
YTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLTNPVLQPRGGTSPYN
TLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLPLNGNFNNSYSLRSGDFPP
GDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGASGGAKGPPPEPPVPPVPGVSEDEAG
GPGGADRAEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDGATSRPLSSPPGRDS
LYASGANLRDSPSYPDSSPEGPNEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGYYQV
RRPSHEGYLAAPSLEGPGPDGDGQMQLVTSL
NT seq 4416 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcttggctgcagcactctggagtctctgtgtgacgactgtcctcgtcacctct
gctacccaaggcctgagccgggctggactcccatttggattgatgcgccgggagctagca
tgcgaaggctaccccattgagctgcggtgcccgggcagtgacgtcatcatggtggagaat
gcaaactatgggcgcacagatgacaagatctgcgatgccgacccttttcagatggagaac
gtgcagtgctacctgcctgacgccttcaaaatcatgtcacagagatgtaataaccgaacc
cagtgtgtggtggtggccggctctgacgcctttcctgacccctgtcctggaacctacaag
tacctggaggtgcagtacgactgtgtcccttacaaagtggagcagaaagtcttcgtgtgc
ccagggacactgcagaaggtgctggagcccacctccacacatgaatcggagcaccagtct
ggcgcatggtgcaaggacccactgcaggcaggtgaccgtatctacgttatgccctggatc
ccctaccgcacggacacactgaccgagtatgcttcctgggaggactatgtggctgcacgc
cacaccaccacgtacagactgcccaaccgtgtagatggcactggctttgtggtatatgat
ggtgccgtcttctataacaaggaacgtactcgcaacattgtcaaatatgacctgcggacc
cgcatcaagagcggagaaacagtcataaacacagccaactaccacgacacctcaccttat
cgctggggaggcaaaaccgacattgacctggcagtggatgagaacgggctgtgggtcatc
tatgccaccgaggggaacaacgggcgtctggtggtgagccagctcaacccctacacactg
cgtttcgagggcacctgggaaacaggctatgacaagcgctcagcctccaatgccttcatg
gtgtgtggtgtcctctatgtgctgcgctctgtttatgtggatgacgacagtgaggcagca
ggcaaccgcgtggactatgcctttaacaccaatgcaaaccgagaggagcccgtcagtctc
gccttccccaacccctaccagtttgtatcttctgttgactacaatccccgggacaaccag
ctgtatgtgtggaacaactatttcgtggtgcgctacagcctggagtttggacccccagat
cccagtgctggcccagccacttccccacctctcagtaccaccaccacagctcggcctacg
cccctcaccagcacagcctcacctgcagccaccactccactccgccgggcgcccctcacc
acgcacccagtaggtgccatcaaccagctgggacctgacctgcctccagccacagcccca
gcacccagtacccggcggcctccagcccccaatctgcatgtgtcccctgagctcttctgt
gaaccccgagaggtccggcgggtccagtggccagctacccagcagggtatgctggtagag
agaccttgccccaagggaactcgaggaattgcctcgttccagtgcctcccagctctgggg
ctctggaatcctcggggccctgacctcagcaactgcacttccccctgggtcaaccaagtc
gcccagaagatcaagagtggagagaatgcagccaacattgctagtgagctggcccgccac
acgcggggctccatctatgctggggacgtgtcctcatcggtgaagctgatggagcaactg
ctagatatcctggatgcccagctccaggccctacggcccattgaacgagagtcagctggc
aagaactacaataagatgcacaagcgagagagaacctgcaaggactatatcaaggctgtg
gtggagacagtggacaacctgcttcggccagaggcacttgagtcatggaaagacatgaat
gccaccgaacaggtccatacggccaccatgctcctagatgtcttagaggagggtgccttc
ctgctggccgacaatgtcagagaacctgctcgcttcttggctgccaagcagaatgtggtc
ctggaggtcactgtcctgagcacagagggtcaagtgcaggagttggtgttcccccaggag
tatgccagtgagagctccattcagctgtccgccaacaccatcaagcagaacagccgcaat
ggtgtggtgaaggttgtcttcattctctacaacaacctgggcctcttcttgtccacggag
aatgccacagtgaagctggcaggtgaggcagggaccggtggccctggaggtgcctccctg
gtggttaactcacaggtcatcgcagcatccatcaataaggagtccagccgtgtcttcctc
atggaccctgtcatctttactgtggcccacttggaggccaagaaccacttcaatgcaaac
tgctccttctggaactactcagagcgctccatgctgggctactggtcaacccagggctgc
cgactggtggagtccaataagacccataccacatgtgcctgcagccacctcaccaacttc
gcagtgctcatggctcaccgagagatctaccaaggccgtattaatgagctgttgctgtca
gtcatcacctgggttggcattgtcatctccctggtctgtctggctatctgcatctccacc
ttctgcttcctgcggggcctgcagaccgaccgcaacaccatccacaagaacctgtgcatc
aacctcttccttgcagagctgctcttcctggttggaatagacaaaactcagtatgaggtc
gcctgccctatctttgcgggcctgctgcactacttcttcctggccgccttctcctggctg
tgcctagagggcgtgcacctctacctcctgctggtcgaggtgttcgagagcgaatattca
cgcaccaagtactattacctgggcggctactgcttcccagccctggtggtaggcatcgca
gccgccattgactaccgaagctacggcactgagaaggcctgctggctgagggtggataac
tatttcatctggagcttcattgggcccgtctcctttgttattgtggtgaacctggtgttc
ctcatggtgaccctgcacaagatgatccgaagctcatccgtgctcaagcctgactccagc
cgccttgacaacatcaagtcctgggcgctgggtgccattgcactgctcttcctgctgggc
ctcacctgggctttcggcctcctcttcatcaacaaggagtcagtagtaatggcttacctc
ttcacaaccttcaacgccttccagggggtcttcatctttgtctttcactgcgccttacag
aaaaaggtgcacaaggagtacagcaagtgcctgcgtcactcctactgctgcattcgctcc
ccacctgggggggctcacggctcccttaagacctcagccatgcgaagtaacacccgctac
tacacagggacccagagccgaatccggaggatgtggaatgacaccgtgaggaagcagaca
gagtcgtcctttatggcaggggacatcaacagcacccccaccctgaaccgaggtaccatg
gggaaccacctactgaccaaccctgtgctacagccccgtgggggcactagcccatacaat
acactcattgcagagtctgtgggcttcaatccctcctcgcccccagtcttcaactcccca
ggaagctacagggaacctaagcaccccttgggcggccgggaagcctgtggcatggacaca
ctgccccttaatggcaacttcaacaacagctactccttgcgaagtggtgatttccctccg
ggggatgggggtcctgagccaccccgaggccgaaacctagcggatgctgcggcctttgag
aagatgatcatctcagagctggtgcacaacaaccttcggggggccagtgggggcgccaaa
ggtcctccaccagagcctcctgtgccacccgtgccaggagtcagtgaggacgaggctggt
gggcctgggggtgctgaccgggctgagattgaacttctctacaaggccctggaggagcca
ctgctgctgccccgggcccagtcggtgctgtaccagagtgatctggatgagtcggagagc
tgtacggcagaggatggggccaccagccggcccctctcctcccctcccggccgggactcc
ctctatgccagcggggccaacctgcgggactcgccctcctacccggacagcagccccgaa
gggcctaatgaggccctgccccctcccccacctgctccccctgggcccccagaaatctac
tacacctctcgcccgccggccctggtggctcggaatcccctacagggctactaccaggtg
cggcggcccagccatgagggctacctggcagcccccagccttgaggggccagggcccgat
ggggatgggcaaatgcagttggtcactagtctctga

DBGET integrated database retrieval system