KEGG   Rattus norvegicus (rat): 65131Help
Entry
65131             CDS       T01003                                 

Gene name
Cldn5
Definition
(RefSeq) claudin 5
  KO
K06087  claudin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    65131 (Cldn5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    65131 (Cldn5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    65131 (Cldn5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    65131 (Cldn5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    65131 (Cldn5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   65131 (Cldn5)
  Exosomal proteins of colorectal cancer cells
   65131 (Cldn5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Motif
Other DBs
NCBI-GeneID: 65131
NCBI-ProteinID: NP_113889
RGD: 68431
Ensembl: ENSRNOG00000045811
UniProt: Q9JKD6
Position
11q23
AA seq 218 aa AA seqDB search
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG
HMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALT
GGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGL
VCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggctgggtgggc
ttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaatatc
gtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagcaccggg
cacatgcaatgcaaagtgtatgagtctgtgctggcgctgagcgcggaggtgcaggcagct
cgggcactcaccgtgggcgctgtgctgctggcgcttgtggcactctttgttaccttgacc
ggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtggcactcacg
ggaggagcgctttatgccctgtgtgggcttctggcactggtgccactctgctggttcgcc
aacatcgtagtccgggagttctatgatccaacggtgccggtgtctcagaagtacgagctg
ggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgtggcggcggcctc
gtgtgctgtggcgcctgggtttgcaccgggcgtccagagttcagttttccagtcaagtac
tcagcaccaaggcgaaccacggccaacggcgattacgacaagaagaactacgtctaa

DBGET integrated database retrieval system