KEGG   Rattus norvegicus (rat): 65132
Entry
65132             CDS       T01003                                 

Gene name
Cldn7
Definition
(RefSeq) claudin 7
  KO
K06087  claudin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    65132 (Cldn7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    65132 (Cldn7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    65132 (Cldn7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    65132 (Cldn7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    65132 (Cldn7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   65132 (Cldn7)
  Exosomal proteins of colorectal cancer cells
   65132 (Cldn7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 Amastin Clc-like OppC_N
Other DBs
NCBI-GeneID: 65132
NCBI-ProteinID: NP_113890
RGD: 68432
Ensembl: ENSRNOG00000017325
UniProt: Q9Z1L1 B0K006
Position
10q24
AA seq 211 aa
MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTG
MMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM
TGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVLLGGA
LLSCSCPGSESKAAYRAPRSYPKSNSSKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctaactcgggcctgcaactactgggcttttcaatggccatgcttggctgggtgggt
ctgatagcgagcactgctatcccacagtggcagatgagctcctatgcaggcgacaacatc
atcacagcccaggccatgtacaaggggctctggatggagtgcgtcacgcagagtaccggc
atgatgagctgcaaaatgtacgactcggtgcttgccctgccagcggccacgcaggccact
cgagccttaatgattgtgtccttggtgttgggcttcttggccatgtttgtcgccacgatg
ggcatgaaatgcacacgctgtgggggagatgacaaagtgaagaaggcccgcatagctatg
actggaggcattattttcatcgtggcaggtcttgctgctttggtagcatgctcctggatt
ggtcatcagattgtcacagacttttataaccccttgacgcccatgaatattaagtacgag
tttggtcctgccatctttatcggctgggcagggtctgctctggtccttctgggaggggcc
ctgctctcttgctcctgccccggcagtgaaagcaaagctgcataccgtgcaccccgctcc
taccctaagtccaactcctctaaggaatacgtgtga

DBGET integrated database retrieval system