KEGG   Rattus norvegicus (rat): 65144Help
Entry
65144             CDS       T01003                                 

Gene name
Pdzk1, Clamp
Definition
(RefSeq) PDZ domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 GRASP55_65 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 65144
NCBI-ProteinID: NP_113900
RGD: 70924
Ensembl: ENSRNOG00000000096
UniProt: Q9JJ40
Position
2q34
AA seq 523 aa AA seqDB search
MASTFNPRECKLSKKEGQNYGFFLRIEKDTDGHLVRVIEEGSPAEKAGLLDGDRVLRING
VFVDKEEHAQVVDLVRKSGNSVTLLVLDGDSYEKAVKHQVDLKELDQSPREPALNEKKPD
LGMNGGVETCAQPRLCYLVKEGNSFGFSLKTIQGKKGVFLTDITPQGVAMKAGVLADDHL
IEVNGENVENASHEEVVEKVTKSGSRIMFLLVDKETARCHSEQKTPFKRETASLKLLPHQ
PRVVVIKKGSNGYGFYLRAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGESVEALD
HDSVVEMIRNGGDQTTLLVLDKEADRIYSLARFSPLLYCQSQELPNGSVKEAPAPISAPL
EAPGSATTEDVGDHKPKLCRLIKEDDSYGFHLNAIRGQPGSFVKEVQQGGPADKAGLENE
DIIIEVNGENVQDEPYDRVVERIKSSGEHVTLLVCGKVAYSYFQAKKIPILSSLADPLVA
GPDEKGETEHDSAESTKDSSHPARDRTLSAASHSSSNSEDTVM
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaccttcaaccccagagagtgtaaattgtccaaaaaagaggggcagaactat
ggcttcttcctccgcattgaaaaggacactgacggtcacctggtccgggtgattgaggag
gggagcccggcagagaaggcagggctcctagacggcgacagagtgctcaggatcaacggg
gtctttgttgacaaggaagagcatgcacaggtggtggatctggtcagaaagagcgggaat
tcagtgaccctgctggttctggatggagactcctatgagaaggctgtaaaacatcaggtg
gacttgaaagaactggatcaaagcccaagggagccagctctgaatgaaaagaaacccgac
cttgggatgaatggaggggtggagacgtgtgcccagccacggctctgctacctggtgaag
gagggcaacagctttggcttctctctgaaaactatccaaggtaaaaagggcgtgttcctg
actgatataacacctcagggcgtggccatgaaagctggtgttctggctgatgatcacttg
attgaagtgaatggagaaaatgtagaaaacgccagtcatgaggaagtggtggaaaaggtg
acaaagtcaggaagccgtatcatgttcctccttgtggacaaagaaactgccaggtgccat
agtgagcagaaaacaccgttcaagagggagacagccagtttgaaactgctgccccaccag
ccccgggtagtagtgatcaagaagggcagcaatggctacggtttctatctgagggcgggc
cctgaacagaaaggtcaaatcatcaaggacatagaacctggaagcccagcagaggcagct
ggcttgaagaacaatgacttggtagttgctgtcaatggcgagtctgtggaagctcttgat
catgacagtgtggtggaaatgattagaaacggtggagaccagactactctgttggtgctg
gacaaggaggcagacagaatctatagcctggctcgtttctctccacttctctactgccaa
agtcaagaactgcctaatggttctgtgaaggaagccccagctcccatctctgctcctctg
gaggccccaggctcagctaccacagaggacgtgggggatcataaacccaagctctgcagg
ctgattaaagaggacgacagctacggctttcacctgaacgccattcggggccagccaggc
tcctttgtcaaggaggtacagcagggtggccctgctgacaaggcagggctggagaatgag
gacatcatcattgaagtgaatggggagaatgtgcaagatgaaccctatgacagagtggtg
gagagaatcaagagcagcggggagcacgtcactctgttggtctgtggaaaggtggcctac
agctattttcaagctaagaaaatccccatcctttcttccttggctgaccccctggtggct
ggtcctgatgaaaaaggagagactgagcatgactcagcagagtccacgaaagactcctcc
cacccagcaagagaccgaactctcagcgcagcctcccactcttcttccaactctgaagac
acggtgatgtga

DBGET integrated database retrieval system