KEGG   Rattus norvegicus (rat): 65146Help
Entry
65146             CDS       T01003                                 

Gene name
Pirb, Lilrb3, NILR-1, Nilr1
Definition
(RefSeq) paired Ig-like receptor B
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04380  Osteoclast differentiation
rno04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    65146 (Pirb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    65146 (Pirb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    65146 (Pirb)
CD molecules [BR:rno04090]
 Proteins
  65146 (Pirb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig OAD_gamma Cadherin_C_2 Neur_chan_memb Protocadherin EphA2_TM
Motif
Other DBs
NCBI-GeneID: 65146
NCBI-ProteinID: NP_113901
RGD: 70895
Ensembl: ENSRNOG00000054954
UniProt: D3ZQX2 A0A140TAJ6
Position
1q12
AA seq 582 aa AA seqDB search
MGTALPPGPYPLPKPFRKALYLCSQAELQPLRRDAMTFTCKALLCLGMTLGLWITVLTEF
LPRPILRVQPDTVVSTQSKVIFFCERSQGAELYCLYKKGNPRNPRCKEIRPKPGKKVEFF
ISKIEPYHAGHYHCYYQIHGQWSEDSDALELVVTGVYDYNELRLSVLPSPVVTVGRNMTL
HCISHSHYDKFILTKEDHKFTSSLDTQCIPPSGQCQALFVMGPMTSNHTGTFRCYGYYKH
TPQLWSIPSEPLEIHISGLSKKPSLLTHQGHILDPGVNLTLQCCSDINYDRFALYKVGGV
DIMQHTSQQTDTGFSMTNFTLGYVHHSTGGQYRCYGAHNLSSEWSASSDPLDILITGPIQ
MSTLPPITSMPPDQLESYVNALIGVSVAFLVFLFILIFIILQRRHQRKFRKDGEEAQKEK
ELQYPTGAVEPISRDRDQQKRSNAAAATQEESVYASVEDMETEDGVELDTWKPPEGDPQG
ETYAQVKPSRLRRVEAIIPSAMSREQLNTKYEQAEEGQEVDGQATESEEPQDVTYAQLCS
RTLRQGTAAPPLSQAGEAPEEPSVYAALATACPGAVPKDKEQ
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggggactgccctgcctccagggccataccctcttcccaaacccttcagaaaggctctg
tatctctgttctcaagcagagttgcagcctctcagaagagatgccatgaccttcacctgc
aaagccctgctctgtcttggaatgactctgggcctctggatcacagtgctgacagagttc
ctccctaggccaatcctcagagtacagccagacactgtggtctctacacagagtaaggtg
atcttcttctgtgagaggagtcaaggagccgaactttattgtctctataaaaagggaaat
ccacgaaatccacggtgcaaagaaattcgacctaaacctggcaagaaggttgaattcttc
atctcaaaaattgaaccgtaccatgcaggacattaccactgttattatcagatccatggt
caatggtcagaggacagtgatgcgctggagctggtagtgacaggagtctatgactacaat
gaactcaggctgtcagtactgcccagccctgtggtgacagtgggaaggaacatgacactg
cactgtatctcacatagtcactatgataaattcattctcaccaaggaagatcacaagttc
accagctcactggacacacagtgtatacctcctagtggacagtgccaagctctgtttgtt
atgggacccatgacatcaaaccacaccgggacattccgatgttatggttactacaagcat
actccacagttgtggtcaatacccagtgagcccctggaaattcatatctcagggctgtcc
aagaagccctctctgctaactcaccaaggacacatcctggaccctggagttaacctcaca
ctgcagtgttgctctgacatcaactatgacagatttgctctgtacaaagttgggggtgtt
gacattatgcagcacactagccagcagactgacactggcttctccatgaccaacttcaca
ctgggctatgtacaccactctactggaggccaatacagatgctatggagcacacaacctc
tcctctgagtggtcagcatccagtgatcccctggacatcttgatcacaggacccattcaa
atgtctaccttgccacccataacatccatgccaccagatcagctggaaagttatgtgaat
gctctgataggagtgtctgtggccttcctggtgttcctcttcatcctcatcttcatcatt
ctccaaagaagacatcagagaaaattcagaaaggatggtgaagaggcccagaaagagaaa
gaactacaatatcctacaggagctgtggagcccataagcagggatagagaccagcagaag
aggtccaatgcagctgctgccacccaggaggaaagcgtttatgcttcagtagaggacatg
gaaactgaggatggtgtggagctggacacttggaaaccacctgagggagatccacaggga
gagacatacgcccaagtaaaaccctccaggctcaggagggtagaagctatcattccttct
gccatgtcaagggagcagctgaacacaaaatatgaacaagcagaagagggccaagaggtg
gacggtcaggctactgaatccgaagagccccaggatgtgacctatgcccagctgtgcagc
aggacactcagacaggggacagctgcacctcctctctcccaggcaggagaagccccagag
gagcccagtgtatatgctgctctagcgactgcttgcccaggagctgttcccaaggacaag
gagcagtga

DBGET integrated database retrieval system