KEGG   Rattus norvegicus (rat): 65151
Entry
65151             CDS       T01003                                 

Gene name
Rida, Hrsp12, PSP1, Psp
Definition
(RefSeq) reactive intermediate imine deaminase A homolog
  KO
K09022  2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    65151 (Rida)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.10  2-iminobutanoate/2-iminopropanoate deaminase
     65151 (Rida)
SSDB
Motif
Pfam: Ribonuc_L-PSP Corona_6B_7B
Other DBs
NCBI-GeneID: 65151
NCBI-ProteinID: NP_113902
RGD: 70940
Ensembl: ENSRNOG00000005437
UniProt: P52759
Structure
PDB: 
1QAH

Position
7q22
AA seq 137 aa
MSSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEANQALK
NLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSR
IEIEAIAVQGPFTTAGL
NT seq 414 nt   +upstreamnt  +downstreamnt
atgtcgtcaataatcagaaaagtgatcagcacttcaaaagccccggcggccattggtgcc
tacagccaagctgtgctagtggacaggaccatttacgtttctggacagataggcatggat
ccttccagtggacaacttgtgccaggaggggtagcagaagaagctaatcaagctcttaaa
aacctgggtgagattctgaaggctgcaggctgtgacttcactaatgtggtgaagacaact
gttttactggctgacataaatgactttggcactgtcaatgagatctacaaaacatatttc
cagggtaaccttcctgccagggctgcttaccaagtcgccgctttacccaaaggaagtcga
attgaaatcgaagccatcgctgtccaggggcctttcaccacagcaggactgtaa

DBGET integrated database retrieval system