KEGG   Rattus norvegicus (rat): 65161
Entry
65161             CDS       T01003                                 

Gene name
Litaf
Definition
(RefSeq) lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
  KO
K19363  lipopolysaccharide-induced tumor necrosis factor-alpha factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    65161 (Litaf)
SSDB
Motif
Pfam: zf-LITAF-like DUF6487
Other DBs
NCBI-GeneID: 65161
NCBI-ProteinID: NP_001099205
RGD: 69294
Ensembl: ENSRNOG00000002520
UniProt: P0C0T0 B2RYP2
Position
10
AA seq 161 aa
MSAPGPYQAAAGPSVMPTAPPTYEETVGVNSYYPTPPAPQPGPATGLITGPDGKGMNPPS
YYTQPVPVPNANAIAVQTVYVQQPISFYDRPIQMCCPSCNKMIVTQLSYNAGALTWLSCG
SLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcggctccaggaccttaccaagcagctgcaggcccttctgtaatgcctactgcaccc
ccaacctatgaagaaacagtgggtgtcaacagttactacccaacgcccccagcacctcag
ccgggaccagccacagggctcattacgggcccggatgggaagggcatgaatccaccttcg
tactacacccagcccgtgcctgtccccaacgccaacgcaattgcagtgcagacggtttat
gtgcagcagcccatctccttctacgaccgccccatccagatgtgctgtccttcctgcaac
aagatgatcgtgacccagttgtcctacaatgcaggagccctcacctggctctcctgtggc
agtctgtgtctgctgggatgcgtcgctggctgctgcttcattccgttttgcgtggacgcc
ctgcaggatgtggaccattactgccccaactgcaaagcgctcctgggcacctacaaacgt
ttgtag

DBGET integrated database retrieval system