KEGG   Rattus norvegicus (rat): 65165
Entry
65165             CDS       T01003                                 

Gene name
Tmed2, Rnp24
Definition
(RefSeq) transmembrane p24 trafficking protein 2
  KO
K20347  p24 family protein beta-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65165 (Tmed2)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    65165 (Tmed2)
SSDB
Motif
Pfam: EMP24_GP25L TerD SdrD_B
Other DBs
NCBI-GeneID: 65165
NCBI-ProteinID: NP_113910
RGD: 69243
Ensembl: ENSRNOG00000001053
UniProt: Q63524
Position
12q15
AA seq 201 aa
MVTLAELLVLLAALLATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQD
METEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVL
VAMTLGQIYYLKRFFEVRRVV
NT seq 606 nt   +upstreamnt  +downstreamnt
atggtgacgctcgcagaactgctggtgctgctggccgcgctgctggccacggcctcgggc
tacttcgtcagcatcgacgcgcacgccgaggagtgcttcttcgagcgggtcacctcgggc
accaagatgggcctcatcttcgaggtggcggagggcggcttcctggacatcgacgtggag
atcacaggaccagataataaaggaatctataaaggagaccgggagtccagcgggaagtac
acgtttgcagcccacatggatgggacatacaagttctgctttagtaataggatgtccact
atgactccaaagatagtgatgttcaccattgacattggggaggctcctaaaggacaagac
atggagacagaagctcatcaaaacaagctagaagaaatgattaatgagctggcagtggcc
atgacagccgtaaagcacgaacaggagtacatggaagtccgggagagaatacacagagcc
atcaacgacaacacaaacagcagagtggtcctttggtccttcttcgaagctcttgttctt
gttgccatgacattgggacagatctactacctgaagagattttttgaagtccggagggtt
gtttaa

DBGET integrated database retrieval system