KEGG   Rattus norvegicus (rat): 65168Help
Entry
65168             CDS       T01003                                 

Gene name
Scamp2
Definition
(RefSeq) secretory carrier membrane protein 2
  KO
K19995  secretory carrier-associated membrane protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65168 (Scamp2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Others
   Others
    65168 (Scamp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCAMP DUF3552
Motif
Other DBs
NCBI-GeneID: 65168
NCBI-ProteinID: NP_076445
RGD: 68348
Ensembl: ENSRNOG00000019136
UniProt: Q5U2U4
Position
8q24
AA seq 329 aa AA seqDB search
MSAFDTNPFADPVDVNPFQDPSVTQLTSAPQSGLAEFNPFSETNAATTVPVTQLPGPSQP
AVLQPSVEPAQPSPQAVAAAAQAGLLRQQEELDRKAAELERKERELQNTAANLHVRENNW
PPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFTSDAAN
GTAFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYFIQLIGLP
NLGTSGWLAALSTVNKGPLAVTIIMMVVAGFFTLCAGLSLFLLQRVHAFYRRTGASFQQA
QEEFSQGIFSSRTFRTAASSAARGTFQGN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccttcgacactaaccccttcgcggacccagtggatgtaaaccccttccaggat
ccttctgtgacccagctgaccagtgctcctcagagtggcctggctgagttcaatcccttc
tcagagacaaatgcagcgacaacagttcctgtcacacaacttcctgggccctcccagcca
gcagttctccagccctcagtggagccagcacagccatcgccccaggctgttgcggctgca
gcccaggcaggcctgcttcggcagcaggaagagttagacaggaaagctgctgagctggaa
cgcaaggagcgagagttgcagaacactgcggcgaatttgcatgtaagagaaaacaactgg
ccgccactcccctcatggtgccctgtgaaaccctgcttctatcaggacttctccacggag
atccctgccgactaccagcggatatgcaagatgctttactatctgtggatgttgcattca
gtgactctgtttctaaacctgcttgcatgcctggcctggttcacaagtgacgcagctaat
ggaacagcctttggcctctccatcctttggtttctgattttcacgccctgtgccttcctt
tgttggtaccgacccatctacaaggctttcaggtctgacaactctttcagcttcttcgtg
ttcttttttgtatttttttgtcaaataggaatctacttcatccagttgattggcttgcct
aacttggggaccagtggttggctcgcagccctctctacagtgaataaggggcccttagct
gtgaccatcatcatgatggtagtggctggcttctttaccctctgtgctgggctctcactc
ttcctcctgcagcgggtccatgccttctaccgccgaacaggagccagcttccagcaggct
caggaagaattctcccagggcatcttcagcagcagaaccttccgcactgctgcctcgtct
gctgcccgaggaaccttccaggggaattag

DBGET integrated database retrieval system