KEGG   Rattus norvegicus (rat): 65180Help
Entry
65180             CDS       T01003                                 

Gene name
Kcnd2, Kv4.2, RK5, Shal1
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 2
  KO
K04892  potassium voltage-gated channel Shal-related subfamily D member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    65180 (Kcnd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    65180 (Kcnd2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   65180 (Kcnd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans DUF3399 BTB_2 Ion_trans_2 Shal-type BTB_3 PKD_channel
Motif
Other DBs
NCBI-GeneID: 65180
NCBI-ProteinID: NP_113918
RGD: 68393
UniProt: Q63881
Structure
PDB: 

Position
4q22
AA seq 630 aa AA seqDB search
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEPAFVSKSGSSFETQHHH
LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
PNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagccggtgttgcagcatggctaccctttgccagggcagccgccattgggtggatg
cctgttgcctccgggcctatgccagctcccccaaggcaggagagaaaaaggactcaggac
gctctaattgtgctgaacgtgagtggcacccgtttccagacatggcaagacaccctggaa
cgatacccagacactctgctgggcagttccgagagagactttttctaccacccagagacc
caacaatatttctttgaccgtgacccagacatcttccgccacatcctcaacttctaccgc
acggggaagcttcactatccccgccatgagtgcatctcggcttatgatgaagaattggcc
ttctttggcctcatcccagaaattattggcgactgctgttatgaggagtacaaggaccgc
aggcgggagaatgcagagcgcctccaggatgatgcagacactgacaatacaggagagagt
gctctgcccaccatgactgctaggcagagggtctggagggcctttgagaacccccacacc
agcaccatggccctggtgttctactatgtgaccgggttcttcattgccgtctcagtcatc
gcgaatgtggtggaaacagttccatgtgggtctagcccaggccacataaaagaactgcct
tgtggggaaaggtatgcagtggccttcttctgcttggataccgcctgtgtcatgatcttt
acggttgagtacttgctacgcctggccgcagcgcctagtcgttaccgttttgtgcgcagt
gtcatgagtatcatcgatgtggtggccatcctaccctattacattgggctggtgatgaca
gacaatgaggatgtcagtggcgcctttgtcacactccgagtctttcgagtcttcaggatc
tttaagttttcccgccactctcaaggcctgcgtatactggggtacacactgaagagctgt
gcgtcagaactgggcttcttgctcttttccctcacaatggctatcatcattttcgctacg
gttatgttctacgcagagaagggctcttcagcaagcaagttcaccagcatccctgcagcc
ttctggtacaccatcgtcaccatgacaacactggggtatggcgacatggtaccaaaaacc
atagcagggaagattttcgggtctatctgctctctgagcggagtcttggtcatcgcgcta
cccgtgcctgtgatcgtgtctaacttcagtcggatctaccaccaaaaccaacgagcggac
aaacgaagggcacagaagaaagcgaggctggccaggatccgggcagccaaaagtggaagt
gcaaatgcctacatgcagagcaagcggaatgggttactgagcaaccaactgcagtcctcg
gaggatgaaccggccttcgttagcaaatctggatccagcttcgagacacaacaccaccac
ctgcttcactgcctggagaaaaccacgaaccatgagtttgtggatgaacaagtctttgaa
gaaagctgcatggaagtggccactgttaatcgcccttcaagtcacagcccctccctctct
tcccaacaaggagtcaccagcacttgctgctcacggagacacaaaaaaactttccgaatc
ccaaatgccaatgtgtcaggaagtcatagaggcagcgtgcaagaactcagtacaattcag
atcagatgtgtggagagaactccactatccaacagccgatccagcttaaatgccaaaatg
gaagagtgtgtcaaactaaactgtgaacaaccttacgtgaccacagcaataattagcatt
ccaacacctccagtaaccaccccagaaggcgacgacaggcccgagtctcctgagtattcg
ggaggaaacatcgtcagggtgtctgctttgtaa

DBGET integrated database retrieval system