KEGG   Rattus norvegicus (rat): 65183
Entry
65183             CDS       T01003                                 

Gene name
Aldh3a2, Aldh4, FALDH
Definition
(RefSeq) aldehyde dehydrogenase 3 family, member A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00053  Ascorbate and aldarate metabolism
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno00770  Pantothenate and CoA biosynthesis
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    65183 (Aldh3a2)
   00053 Ascorbate and aldarate metabolism
    65183 (Aldh3a2)
   00620 Pyruvate metabolism
    65183 (Aldh3a2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    65183 (Aldh3a2)
   00561 Glycerolipid metabolism
    65183 (Aldh3a2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    65183 (Aldh3a2)
   00310 Lysine degradation
    65183 (Aldh3a2)
   00330 Arginine and proline metabolism
    65183 (Aldh3a2)
   00340 Histidine metabolism
    65183 (Aldh3a2)
   00380 Tryptophan metabolism
    65183 (Aldh3a2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    65183 (Aldh3a2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    65183 (Aldh3a2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     65183 (Aldh3a2)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 65183
NCBI-ProteinID: NP_113919
RGD: 61866
Ensembl: ENSRNOG00000002342
UniProt: P30839 G3V9W6
Position
10q22
AA seq 484 aa
MERQVQRLRQTFRSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLSKSELNAYSHE
VITILGEIDFMLGNLPELASARPAKKNLLTMMDEAYVQPEPLGVVLIIGAWNYPFVLTLQ
PLVGAIAAGNAAIVKPSELSENTAKILAELLPQYLDQDLYMIVNGGVEETTELLRQRFDH
ILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRITWGKYMNCGQT
CIAPDYILCEASLQDQIVQKIKDTVKDFYGENVKASPDYERIINLRHFKRIKSLLEGQKI
AFGGETDEATRYIAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVEEAINFINDREKPLA
LYIFSHNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFS
HQRPCLLKGLKGESVNKLRYPPNSESKVSWSKFFLLKQFNKGRLQLLLLVCLVAVAAVIV
KDQL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggagcgacaggtccaacgacttcgccagacgttccggtccggccgatcgcggccgctg
cgtttccgactgcagcagctcgaggccctccggaggatggtgcaagagcgagagaaggac
atcttggcagccatcgcagcagacctgagcaaaagtgaactcaatgcatacagtcatgaa
gtcattaccatccttggggagattgacttcatgctggggaatcttcctgaattggcctct
gctcggccagcgaagaagaacctgcttaccatgatggacgaggcctatgttcagccagag
cctctgggagtcgtgctgattattggagcttggaactatccttttgttctgaccctgcag
ccactggtgggagccattgctgcaggaaatgctgccattgttaagccctcggaactcagt
gaaaacacggctaagatcttggctgaactcctccctcagtatttagaccaggacctgtac
atgattgttaatggcggcgttgaagaaaccacagagcttctgaggcagcggtttgatcac
attctctacacaggaaacaccgcagttggaaaaattgtcatggaggctgctgccaagcac
ctgacccctgtgaccctggagctcgggggcaaaagcccatgctacattgacagagactgt
gacctggacgttgcttgcagacggataacctggggaaagtacatgaattgtggtcagacc
tgtattgctcctgactatatcctgtgtgaagcctccctccaggatcaaatcgtacagaag
attaaggatacggtgaaggacttttatggggaaaatgtaaaagcttctcctgattatgaa
aggatcatcaaccttcgtcactttaagaggataaaaagtttgcttgaaggacagaaaata
gcttttggtggggagactgatgaagctacacgctacatagccccaaccatactcactgat
gttgaccctaactccaaggtgatgcaagaagaaatttttggaccaattctcccaatagtg
tctgtgaaaaatgtggaggaagccataaatttcataaatgatcgcgaaaagcccctggca
ctctacatattttctcacaacaataagctcatcaaacgggtgattgatgagacatccagt
ggtggagtcacaggcaatgatgtcatcatgcacttcactgttaattctttgccctttgga
ggtgtgggtgccagtggaatgggggcttatcatggcaaatacagtttcgataccttttct
catcagcgcccctgcttgttaaaagggttaaagggagagagtgttaacaaactcaggtac
cctcccaacagcgagtccaaggtcagctggtcgaaattcttcctgctgaaacagttcaac
aaaggaaggctgcagctgctgcttctcgtgtgcttggttgcggttgcagctgtgatcgtc
aaggatcagctgtga

DBGET integrated database retrieval system