KEGG   Rattus norvegicus (rat): 65187
Entry
65187             CDS       T01003                                 

Gene name
Gabrq
Definition
(RefSeq) gamma-aminobutyric acid type A receptor theta subunit
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04723  Retrograde endocannabinoid signaling
rno04727  GABAergic synapse
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65187 (Gabrq)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    65187 (Gabrq)
   04723 Retrograde endocannabinoid signaling
    65187 (Gabrq)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    65187 (Gabrq)
   05033 Nicotine addiction
    65187 (Gabrq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    65187 (Gabrq)
Ion channels [BR:rno04040]
 Ligand-gated channels
  GABA-A
   65187 (Gabrq)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 65187
NCBI-ProteinID: NP_113921
RGD: 68331
Ensembl: ENSRNOG00000053402
UniProt: Q91ZM7
Position
Xq37
AA seq 635 aa
MLRAAELLLLIRTWLAESNDPSPTPKFHFELSSSMPEVILDLFNCKNCANEAVVQKILDR
VLSTYDVRLRPNFGGAPVPVSISIYVSSIEQISEINMDYTITMFLHQTWKDTRLAYYETN
LNLTLDYRMHEKLWVPDCYFVNSKDAFVHDVTAENRVFQLHPDGTVQYGIRLTTTAACSL
DLQKFPMDKQSCKLEVESYGYTVEDIVLSWEDDNAIHITDELHIPQYTYLGRTITSKEVY
FYTGSYMRLIVKFQVQREVRSYLVQVYWPTVLTTILSWISFWMNYGSSAARVTIGLTSIL
VLTTIDSHMRDKLPHISCIKAIDIYILVCLFFVFLSLLEYVYINYLFFSQAPRRNHRRCR
KPRRVVARYRYQEVVVAHVQDGLINVEDRVEDRAGPLPDSPMQAHLASQESLGSLLFTSE
EAQLATSESLSLLSSASSQVQLATGESLGDLPSTSEQTLPDYTIHFHGFLTNDSILPIKI
RSHSDALGDEDSEESLSSEESYGHGGSPTGRLKLQISQRCVQEASWDIDKIESLQDDISI
KSSWLGLDEQRKGDADSIWSLTDEELMACDQEKDSSSSSESEESCSPSPGCSFNEGFSFQ
LFNPNRVPKVDRWSRFLFPLSFGLFNVVYWLYHMY
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgctgcgagccgctgagctcctgctgctcattaggacttggctggcagagagtaacgac
cccagtcccaccccaaaattccacttcgagctctcctccagcatgcctgaagtcatcctg
gatctcttcaactgcaaaaattgtgcaaatgaagctgttgttcaaaagattttggacagg
gtcctgtcaacatatgatgtccgactgagaccaaattttggaggagcacctgtgcctgtg
tcaatatctatctatgtctccagtattgaacagatctcagaaataaacatggactatacc
atcacaatgtttctgcatcagacttggaaggacacgcgcttagcttactatgagaccaac
ctgaacctgactctggactatcggatgcatgagaagctctgggtccctgactgctacttt
gtgaatagcaaagatgcctttgtgcatgatgtaactgcggagaatcgtgtatttcaactt
cacccagatgggacagtgcaatatggcatccgacttaccacaacagcagcctgttccctg
gatctgcaaaaattccctatggacaaacaatcctgcaagctggaggtggagagctatggc
tacactgtcgaagacattgtgttatcctgggaagatgataatgccatccacattactgac
gagctacacatccctcagtacacctacctggggaggacaattaccagcaaggaggtgtac
ttctacacaggctcctacatgcgcctgatagtgaagttccaggttcagagggaagtccgc
agttaccttgtgcaggtctattggcccacagtcctcaccaccattctctcctggatatca
ttttggatgaactatggttcctctgcagccagggtaactattggactaacttcaatcctt
gtcctgactaccatcgactcacatatgcgggataaactcccccatatttcctgtatcaaa
gccattgacatctacatccttgtgtgcctgttcttcgttttcctgtccctgctggagtat
gtctacatcaactaccttttcttcagccaagcacctcggcgtaatcacaggagatgcagg
aaacccaggagagttgttgcccgataccgctaccaagaagtggtggtagcacatgtgcag
gatggcctgataaatgtggaagacagagtggaagacagagctggtccccttcctgacagc
cccatgcaggctcatctggcaagccaggaaagtctaggatctttgttgttcacttcagag
gaggctcaactggctacttcagaaagcctcagcctactctcgtctgcctcaagccaggtc
caattggccactggagaaagcctgggtgatctgccctccacctctgagcaaacactgcct
gactataccattcactttcatggttttctcactaatgacagtattctccccatcaaaatc
cgcagccattctgatgccctgggtgatgaagactccgaagaaagcctaagctctgaggag
agctatggccatggaggcagccccactggaaggctcaagctccagattagccagaggtgt
gtgcaagaagcaagttgggacattgataagattgagagcttacaggatgacatcagtatc
aagagcagctggcttggccttgatgaacaacgcaaaggggatgctgacagtatctggagc
cttactgatgaggagctcatggcctgtgaccaagagaaggacagtagcagtagctcagag
tctgaggagagttgctccccaagccctgggtgctccttcaatgaagggttctcttttcag
ctctttaaccctaaccgggtccctaaggttgacaggtggtcccgtttcctcttccctctt
tcctttgggttgttcaatgtggtttactggttataccatatgtattag

DBGET integrated database retrieval system