KEGG   Rattus norvegicus (rat): 65189
Entry
65189             CDS       T01003                                 

Symbol
Stk3
Name
(RefSeq) serine/threonine-protein kinase 3
  KO
K04412  serine/threonine kinase 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    65189 (Stk3)
   04390 Hippo signaling pathway
    65189 (Stk3)
   04392 Hippo signaling pathway - multiple species
    65189 (Stk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    65189 (Stk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   65189 (Stk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH ABC1 Pkinase_fungal Abi_2 Fib_succ_major
Other DBs
NCBI-GeneID: 65189
NCBI-ProteinID: NP_113923
RGD: 68412
Ensembl: ENSRNOG00000011278
UniProt: O54748 B1WBQ5
Position
7
AA seq 491 aa
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKNAKPVSILRELITEGMEIKAK
RHEEQQRELEDEEENSDEDELDSHTMVKTSSEGVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCDQSMREPCPM
SNNVFPDNWRVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELHQRYSAKRQPILDA
MDAKKRRQQNF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggagcagccgccggcgcccaagagtaagctaaaaaagctgagtgaagacagtttgact
aagcagcctgaagaggtctttgatgttttggagaagcttggagaagggtcttatggaagt
gtttttaaagcaatacataaggaatctggtcaagttgttgcaattaagcaagtacctgtt
gagtcagatcttcaggaaataatcaaagaaatttccataatgcaacaatgtgacagccct
tacgtggtgaagtactatggcagttactttaagaacacagacctctggattgttatggag
tactgtggagccgggtccgtttcagacataattagattacgaaacaagacattaacggaa
gatgaaattgcaactattctaaaatccacgttgaaaggattagaatatttgcattttatg
aggaaaatacacagagatataaaagctgggaatattctcctcaatacagaaggacatgca
aagcttgcagattttggagtggctggccagttaacagacacgatggcaaaacgcaatact
gtaataggaaccccgttttggatggctcccgaggtaattcaagaaataggttacaactgt
gtggctgacatctggtcccttggcattacgtctatagaaatggcagaaggaaaacctcct
tatgctgatatacatccaatgagggctatttttatgattcctacaaacccaccaccaaca
ttcaggaaacctgagctctggtctgacgacttcacggattttgtgaagaagtgcttggtg
aagagtcctgagcagagggccactgccacccagctgttacagcatcctttcatcaagaat
gcgaagcccgtgtcgatattgagagagctgatcacggaaggcatggaaatcaaggccaag
cggcatgaggagcagcagcgagagctggaggacgaggaggaaaactcggatgaagatgag
ctggattcgcacactatggtgaagactagttcagaaggtgtgggcacaatgcgggccacc
agcacgatgagtgaaggggcccagaccatgattgaacacaacagcaccatgctagagtcg
gacctggggaccatggtgataaacagtgaggatgaagaggaggaagacggaaccatgaaa
agaaatgcaacgtcaccccaagtacaaagaccttctttcatggactactttgataagcag
gacttcaagaacaagagtcatgaaaattgtgatcagagcatgcgtgagccatgccctatg
tcaaacaatgtttttcctgacaactggagagttcctcaagatggagactttgatttttta
aaaaatctaagtttagaagaactacagatgcggctaaaagcactggaccccatgatggaa
cgagaaatagaagaactgcatcaaagatacagtgcgaaaagacagcccatcctggatgcc
atggatgccaaaaagaggaggcagcagaatttctga

DBGET integrated database retrieval system