KEGG   Rattus norvegicus (rat): 65193
Entry
65193             CDS       T01003                                 

Gene name
Nkx6-1, Nkx6.1, Nkx61, Nkx6a
Definition
(RefSeq) NK6 homeobox 1
  KO
K08030  homeobox protein Nkx-6.1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    65193 (Nkx6-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    65193 (Nkx6-1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    65193 (Nkx6-1)
SSDB
Motif
Pfam: Homeodomain PKK
Other DBs
NCBI-GeneID: 65193
NCBI-ProteinID: NP_113925
RGD: 69318
Ensembl: ENSRNOG00000002149
UniProt: O35762
Position
14p22
AA seq 365 aa
MLAVGAMEGPRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPTGPPSSSSSSSSSSSP
SPPLGAHNPGGLKPPAAGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASP
SGSSSSSSSSASATSASAAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSP
SAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHT
RPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEM
ATAKKKQDSETERLKGTSENEEDDDDYNKPLDPNSDDEKITQLLKKHKSSGGSLLLHASE
AEGSS
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgttagctgtgggggcgatggagggcccccggcagagcgcgttcctgctcagcagcccg
cccttggccgccctgcacagcatggccgagatgaagaccccgctctaccctgccgcctat
cccccgctgcccaccgggcccccctcctcctcgtcctcgtcctcctcgtcctcgtcgccc
tccccacctttgggcgcacacaacccgggcggtttgaagcccccggccgcggggggcctc
tcgtccctgggcagccccccgcagcagctttcggcggccactccgcacggcatcaacgac
atcctgagccggccctccatgccggtggcctcgggggccgccctgccctccgcctcgccc
tcggggtcttcttcctcctcctcctcgtccgcctccgccacctcggcctctgcggccgcc
gctgctgctgccgctgccgccgccgctgccgcctcatcgcccgccgggctgttggccggc
ctgccccgcttcagcagcctgagccctccgccaccgccgcccgggctctactttagcccc
agcgccgcggccgtggccgccgtgggccggtaccccaagcccctggccgagctgcccggt
cggacgcccatcttctggcctggggtgatgcagagcccgccttggagggacgcgcgcctt
gcctgtaccccccatcaaggatccattttgttggacaaagatgggaagagaaaacacacc
agacccacattctccggccagcagatcttcgccctggagaagactttcgaacaaacgaag
tacttggcaggaccagagagagcacgcttggcctattctctggggatgacggagagtcag
gtcaaggtctggttccagaatcggcggaccaagtggagaaagaagcacgcagccgagatg
gccaccgccaagaagaagcaggactcggagactgagcggctcaaggggacttcggagaac
gaggaggacgacgacgattacaacaagcccctggacccgaactctgacgacgagaaaatc
actcagctgctgaaaaagcacaaatccagcggaggcagcctcctgctgcacgcgtcggag
gccgagggctcgtcctga

DBGET integrated database retrieval system