KEGG   Rattus norvegicus (rat): 65197Help
Entry
65197             CDS       T01003                                 

Gene name
Slc2a5
Definition
(RefSeq) solute carrier family 2 member 5
  KO
K08143  MFS transporter, SP family, solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    65197 (Slc2a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    65197 (Slc2a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   65197 (Slc2a5)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    65197 (Slc2a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 65197
NCBI-ProteinID: NP_113929
RGD: 68328
Ensembl: ENSRNOG00000017693
UniProt: P43427
Structure
PDB: 

Position
5q36
AA seq 502 aa AA seqDB search
MEKEDQEKTGKLTLVLALATFLAAFGSSFQYGYNVAAVNSPSEFMQQFYNDTYYDRNKEN
IESFTLTLLWSLTVSMFPFGGFIGSLMVGFLVNNLGRKGALLFNNIFSILPAILMGCSKI
AKSFEIIIASRLLVGICAGISSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQLFG
LRSVLASEEGWPILLGLTGVPAGLQLLLLPFFPESPRYLLIQKKNESAAEKALQTLRGWK
DVDMEMEEIRKEDEAEKAAGFISVWKLFRMQSLRWQLISTIVLMTGQQLSGVNAIYYYAD
QIYLSAGVKSNDVQYVTAGTGAVNVFMTMVTVFVVELWGRRNLLLIGFSTCLTACIVLTV
ALALQNTISWMPYVSIVCVIVYVIGHAVGPSPIPALFITEIFLQSSRPSAYMIGGSVHWL
SNFIVGLIFPFIQVGLGPYSFIIFAIICLLTSIYIFMVVPETKGRTFVEINQIFAKKNKV
SDVYPEKEEKELNDLPPATREQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaggatcaagagaagacagggaagctgaccctggtccttgccctggcaact
ttcctagctgcctttggctcctccttccagtatgggtacaacgtggctgctgtcaactcg
ccctcagagttcatgcagcagttctacaatgacacctactacgacagaaacaaggagaac
attgagtccttcaccctgacgctgctgtggtccctgactgtctccatgttcccctttgga
ggttttataggatctctcatggttggattcttggtgaataacttgggcagaaaaggggcc
ttactgttcaacaacatattctccatcctgccggccatcttgatggggtgcagcaaaatt
gccaaatcctttgagataataattgcttccagacttctggttggaatatgtgcaggtata
tcttccaacgtggtccccatgtacttaggggagctagcccccaaaaacctgcgaggggct
cttggagtggttcctcagctcttcatcactgtgggcatccttgtggcccagctgtttggc
cttcggagtgtcttggcaagcgaggaaggctggccaatcctcctgggtctgactggagtc
cctgccggcctgcagctcctcttgctgcccttctttcctgagagcccccgctacctgctg
attcagaagaaaaatgaatcagctgctgagaaagcccttcagacccttcgaggttggaaa
gatgtggacatggagatggaggaaatccggaaggaggatgaggctgagaaggcggcaggc
ttcatctctgtgtggaagctgttccgcatgcagtccctccgctggcaactcatctccacg
atcgtcctcatgaccggccagcagctgtcaggagtgaacgcgatttactactacgctgac
cagatctacctcagcgcaggggtgaaaagcaacgacgtccaatatgtgacggctgggact
ggggccgtcaacgtgttcatgaccatggtcacggtttttgtggtagagctttggggacgt
cggaatcttctcctcatcggcttctccacctgcctcacagcttgcatagtgctgacggtc
gcactggcactgcagaacaccatctcctggatgccctatgtcagcatcgtctgtgtcatt
gtctacgtcataggacacgccgtggggcccagtcccatccctgccctgttcatcaccgag
atcttcctgcaatcctctcgaccatccgcctacatgatcggaggcagcgtccactggctc
tctaacttcatcgtgggcctcatcttcccgttcattcaagtgggccttggtccttacagc
ttcatcatctttgcgattatatgtctcctcacctccatctacatcttcatggtcgtccca
gagaccaagggcaggacgtttgtcgagatcaaccagatttttgccaagaagaacaaggta
tcggacgtatatccggagaaggaggaaaaggagcttaatgacctcccacctgctacccgg
gagcagtag

DBGET integrated database retrieval system