KEGG   Rattus norvegicus (rat): 65199Help
Entry
65199             CDS       T01003                                 

Gene name
Kcnip3, Csen, Dream, rKChIP3
Definition
(RefSeq) potassium voltage-gated channel interacting protein 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 65199
NCBI-ProteinID: NP_115851
RGD: 70888
Ensembl: ENSRNOG00000014152
UniProt: Q9JM47
Position
3q36
AA seq 256 aa AA seqDB search
MQRTKEAMKASDGSLLGDPGRIPLSKREGIKWQRPRFTRQALMRCCLIKWILSSAAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSIYDMMGRHTYPILRKDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQ
KDENIMSSMQLFENVI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggaccaaggaagcaatgaaggcatcggatggcagcctcctgggagaccctggg
cgcataccgctgagcaagagggaaggcatcaagtggcagaggccacggttcacccgccag
gccctgatgcgttgctgcttaatcaagtggatcctgtccagtgctgccccacaaggctca
gacagcagtgacagtgaactggagttgtccacggtgcgccatcagccagagggcttggac
cagctacaggcccaaaccaagttcaccaagaaggagctgcagtccctgtaccgaggcttc
aagaacgaatgtcccacgggcctggtcgatgaagataccttcaaactcatttattcccag
ttcttcccccagggagatgccaccacctatgcacacttcctcttcaatgccttcgatgct
gatgggaacggggccatccactttgaggactttgtggttgggctctccatcctgcttcga
gggaccgtccatgagaagctcaagtgggccttcaatctctacgacatcaacaaggacggt
tacatcaccaaagaggagatgctggccatcatgaagtccatctacgacatgatgggccgc
cacacctaccctatcctgcgaaaggacgcacctctggagcatgtggagaggttcttccag
aaaatggacaggaaccaggatggagtagtgactattgatgaatttctggagacttgtcag
aaggacgagaacatcatgagctccatgcagctgtttgagaacgtcatctag

DBGET integrated database retrieval system