KEGG   Rattus norvegicus (rat): 65204Help
Entry
65204             CDS       T01003                                 

Gene name
Cnn1
Definition
(RefSeq) calponin 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Calponin CH CAMSAP_CH CDC24
Motif
Other DBs
NCBI-GeneID: 65204
NCBI-ProteinID: NP_113935
RGD: 621883
Ensembl: ENSRNOG00000027736
UniProt: Q08290
Position
8q13
AA seq 297 aa AA seqDB search
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGSNFMDGLKDGIIL
CEFINKLQPGSVKKVNESTQNWHQLENIGNFIKAITEYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERRFEPEKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELDEPTHNHHPHNYYNSA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcacactttaaccgaggtcctgcctacggcctgtctgctgaggtaaagaac
aagctggcccagaaatacgaccaccagcgtgagcaggagctgagagagtggatcgaaggg
gtgacaggccgccgcatcgggagcaacttcatggatggcctcaaggacgggatcattctt
tgcgaatttatcaacaagctccagccgggatctgtgaagaaggtcaatgagtcaacccag
aactggcaccagctggagaacataggaaatttcatcaaagccattaccgagtatggggtg
aaaccccacgacatttttgaggccaatgacctgtttgaaaacaccaatcatacacaagtt
cagtctactctcttggctctggccagcatggcaaagacaaaaggaaacaaagtcaatgtg
ggggtcaaatatgcagagaaacaagagcggagatttgagcctgagaagctgagagaaggc
aggaacatcattggcctacagatgggcaccaataagtttgccagtcagcagggcatgaca
gcctatggtacccggcgtcacctctatgatcccaaactgggtacagatcaacccctggat
caggcaactatcagtctacagatgggtaccaacaagggcgccagccaggctggcatgact
gcaccgggcaccaagcggcagatctttgagccaggtctgggcatggaacactgtgacacg
ctcaacgtcagcttgcagatgggcagcaacaagggggcctcacagaggggcatgacggtg
tatgggctgccccgccaggtgtatgatcccaagtactgcctgaccccggaatatccagag
ctggacgagcccacccacaatcaccacccacacaactactataactctgcctag

DBGET integrated database retrieval system