KEGG   Rattus norvegicus (rat): 65205Help
Entry
65205             CDS       T01003                                 

Gene name
Mmp16, Mt3-mmp
Definition
(RefSeq) matrix metallopeptidase 16
  KO
K07996  matrix metalloproteinase-16 (membrane-inserted) [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    65205 (Mmp16)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    65205 (Mmp16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    65205 (Mmp16)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     65205 (Mmp16)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M10
   65205 (Mmp16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Peptidase_M66 Peptidase_M54 Metallopep Reprolysin_3 DUF4953
Motif
Other DBs
NCBI-GeneID: 65205
NCBI-ProteinID: NP_542954
RGD: 620199
Ensembl: ENSRNOG00000005708
UniProt: O35548
Position
5q13
AA seq 547 aa AA seqDB search
MILLAFSSGRRLDFVHRSGVFFFQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDRSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSVPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITIW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDK
EGLSPPP
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgatcttactcgcattcagctctggaagaaggttggatttcgtgcatcgttcgggggtg
tttttcttccaaaccttgctttggattttatgtgctacagtctgcggaacggagcagtat
ttcaatgtggaggtttggttacagaaatacggctaccttccaccgactgaccccagaatg
tctgtgctgcgctctgcagagaccatgcagtcagccttagctgccatgcagcagttctat
ggcattaacatgacaggaaaagtggacagaaacacaattgactggatgaagaagcctcga
tgtggtgtaccagaccaaacaagaggcagctctaaattcaacatccgacgaaagcgctat
gcattaactgggcagaagtggcaacacaagcatatcacttacagtataaagaacgtaact
cccaaggttggagatcctgagacccggagagcaattcgccgtgcctttgatgtgtggcag
aatgtaacacctctaacgtttgaagaagttccctacagtgaactagaaaatggcaaacgt
gatgtggatataaccatcatttttgcttctggtttccatggagacagatccccctttgat
ggggagggaggatttttggcccatgcttatttccctgggccaggaattggaggcgatact
cattttgattctgatgagccatggacactgggaaatcccaatcatgatggaaatgattta
tttcttgtagcagtccatgagctgggacatgctctagggctggagcattccaacgaccca
acagctatcatggcaccattttaccagtacatggaaacagacaacttcaagcttcctaat
gatgatttgcaaggcatccagaagatatatggtccacctgacaagatccctccacctaca
agacctctaccgacagtgccccctcaccgatctgtccctccggccgacccaaggaaaaat
gacaggcccaaacctcctcgacctcccactggcagaccttcctatccaggagccaaaccc
aacatctgtgatgggaacttcaacactctagctattcttcgaagggagatgtttgttttc
aaggaccagtggttttggcgagtgagaaacaacagggtgatggatggataccccatgcaa
attacttacttctggcggggccttcctcccagtattgatgcagtttatgaaaacagtgat
ggaaattttgtcttctttaaaggtaacaaatactgggtgttcaaagacacaactcttcaa
cctggataccctcatgacttgattacccttggaaatggaatcccccctcatggtattgat
tctgccatatggtgggaagatgttggcaaaacctatttcttcaaaggcgaccggtattgg
agatatagtgaagaaatgaaaaccatggaccctggctatcccaagcccatcaccatctgg
aaaggaatccctgaatcacctcagggagctttcgtccacaaggaaaatggctttacctat
ttctacaaaggaaaggagtattggaaattcaacaaccagatactcaaagtagaacctggg
tatccaagatccatcctcaaggactttatgggctgtgatggaccaacagaccgagataaa
gaaggtctcagcccaccaccatga

DBGET integrated database retrieval system