KEGG   Rattus norvegicus (rat): 65272Help
Entry
65272             CDS       T01003                                 

Gene name
Kcnk10, TREK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 10
  KO
K04920  potassium channel subfamily K member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    65272 (Kcnk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    65272 (Kcnk10)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    65272 (Kcnk10)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     65272 (Kcnk10)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   65272 (Kcnk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans DUF2390 PLC-beta_C PDZ_3 E1-E2_ATPase
Motif
Other DBs
NCBI-GeneID: 65272
NCBI-ProteinID: NP_075584
RGD: 619732
Ensembl: ENSRNOG00000003813
UniProt: Q9JIS4
Position
6q32
AA seq 538 aa AA seqDB search
MKFPIETPRKQVNWDPKVAVPAAAPPVCQPKSATNGHHPVPRLSISSRATVVARMEGASQ
GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHICVS
PQELETLIQHALDADNAGVSPVGNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG
KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI
LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV
WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV
EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP
NNLRLKGPEQLNKHGQGASEDNIINKFGSTSKLTKRKNKDLKKTLPEDVQKIYKTFRNYS
LDEEKKEDETEKMCNSDNSSTAMLTECIQQQAEMENGMVPMDTKDQGLENNSLLEDRN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccaatcgagacgccaagaaagcaggtgaactgggatcctaaagtggccgtg
cctgcagcagccccaccagtgtgccagcccaagagtgccactaacgggcaccatcctgtt
cctcgactctccatttcctccagagccacggtggtagccaggatggaaggcgcctcccag
ggaggcctgcaaacagttatgaaatggaaaacagtggttgccatctttgtggtggtcgtg
gtctacctcgtcaccggtggccttgtcttccgggcattggaacagccctttgagagcagt
cagaagaacacaattgccttggagaaggcagaattcttgagagatcatatctgtgtgagc
ccccaggaactggagacactgatccagcacgcacttgatgctgataatgcaggggtcagc
ccggtaggaaactcctccaacagcagcagtcactgggacctcggaagtgccttcttcttt
gctgggacggtcatcacgaccatagggtatgggaatattgctccgagtactgaaggaggc
aaaatcttttgtattttatacgccatctttgggatcccgctcttcggtttcttattggct
ggaattggagaccaacttggaaccatctttggcaaaagcattgcaagagtggaaaaggtt
ttccgaaaaaagcaagtgagtcagaccaagatccgggtcatctcaactattcttttcatc
ttggctggctgcatcgtgtttgtgacgatccctgctgtcatctttaaatacatagagggc
tggaccgccttggagtccatctactttgtggtagtcactctgaccacagtgggctttggt
gattttgtggcagggggaaatgctggcatcaattaccgagaatggtacaagccgctggtg
tggttttggatccttgttggccttgcctactttgcagctgtcctcagtatgattggagac
tggctgcgagttttatccaaaaagacaaaagaagaggtgggtgagatcaaagcccatgca
gctgaatggaaggctaatgtcactgctgagttccgggagacgagacgacggctcagcgtt
gagatccatgacaagctgcaacgggcagccaccatccgaagtatggagcgccggagactg
ggattggaccagagggcccactcactggacatgctttcccccgagaagcgctctgtcttt
gcagccctggacacaggccgtttcaaggcctcatcccaggagagtatcaacaacagaccc
aataacctacgccttaaggggccagaacagctcaacaaacacgggcagggcgcttctgag
gacaacatcatcaacaagtttgggtccacctccaaactcacaaagaggaaaaacaaagat
ctcaaaaagaccttacctgaggatgttcagaaaatctacaaaaccttccggaattactct
ctggatgaagagaagaaagaggacgagacagagaagatgtgtaactcagacaactccagc
acagccatgctgacagagtgcatacagcagcaagctgagatggagaatggaatggtaccc
atggacaccaaagaccaggggctggagaacaattctttacttgaagacagaaactaa

DBGET integrated database retrieval system