KEGG   Rattus norvegicus (rat): 65274Help
Entry
65274             CDS       T01003                                 

Gene name
Nup62, Np62
Definition
(RefSeq) nucleoporin 62
  KO
K14306  nuclear pore complex protein Nup62
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    65274 (Nup62)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    65274 (Nup62)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     65274 (Nup62)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nsp1_C DUF4164 Pam17 YscO-like Nup188_C
Motif
Other DBs
NCBI-GeneID: 65274
NCBI-ProteinID: NP_075586
RGD: 619938
Ensembl: ENSRNOG00000048733
UniProt: P17955
Structure
PDB: 

Position
1q22
AA seq 525 aa AA seqDB search
MSGFNFGGTGAPAGGFTFGTAKTATTTPATGFSFSASGTGTGGFNFGTPSQPAATTPSTS
LFSLATQTSTTQTPGFNFGTTPASGGTGFSLGISTPKLSLSSTAATPATANTGSFGLGSS
TLTNAISGASTSSQGTAPTGFVFGSSTTSAPSTGTTGFSFTSGSASQPGASGFNIGSVGS
LAQPTALSGSPFTPATLATTTAGATQPAAATPTAATTSAGSTLFASIAAAPASSSTTVLS
LSAPATTAATPTAGTLGFSLKAPGAAPGASTTSTTTTTTTTTTTASTSSSTTTTGFALSL
KPLVPAGPSSVAATALPASSTAVGTTTGPAMTYAQLESLINKWSLELEDQERHFLQQATQ
VNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQ
SGTIYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNMAGGPADTSDPLQQICKI
LNAHMDSLQWVDQSSALLQRRVEEASRVCESRRKEQERSLRIAFD
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggtttaactttggaggcaccggggctcctgctggcggctttacatttgggacc
gcaaagactgcgaccaccacacccgccactggcttttccttctctgcttctggcaccggc
accggagggtttaattttgggactccctcccagccagctgcgaccaccccttccaccagc
ctcttctcacttgccacacagacctcaaccacacagaccccaggattcaactttggaaca
acacctgcttctgggggaacaggcttctccctggggatcagcaccccaaagctcagccta
agtagcacagccgccacaccagccacagccaacactggcagctttgggcttggcagcagt
actcttaccaatgccatctcaggtgccagcacctccagccaggggacagcccccactggc
tttgtctttggctcttctaccacctctgctccgtccaccggcaccacgggattctcattc
accagtggcagtgcatcccagcctggagcctccggcttcaacattggctctgtgggtagt
ttggcccagcccacagcactgtctggctctcccttcactccagccactctggcgacaact
acggcaggagcaacacagccagctgctgctacacccactgctgccaccaccagtgcaggg
tctacactgtttgcttcaatagctgctgctcctgcctcatccagtactacagtgctttcc
ctctcagctccagcgacaactgcagccactcctactgctgggactttgggcttcagcctc
aaggcccctggagcagctcctggtgcctccaccaccagcaccaccactactactaccacc
accactactactgcctccacctcctcctccaccacgaccactggctttgccttaagcctg
aaacccctggtgccagctggccccagcagcgtggcagctactgctctgcctgcctccagc
acagcagttgggactacgacgggtccagcaatgacctacgcgcagctggaaagcctgatc
aacaagtggagtctggagctggaggaccaggagcggcacttcctgcagcaggccacgcag
gtcaatgcctgggaccgcacactgattgagaatggggagaagatcaccagcctgcaccga
gaggtggaaaaggtgaagctggatcagaagcgtctggaccaggagctggactttatcctg
tcacagcagaaggagctggaagaccttctgagcccgttagaggagtcagtgaaggagcaa
agtggcaccatctaccttcagcatgctgatgaggagcgtgagaagacctacaagctggct
gagaacatcgatgctcagctcaagcgcatggcccaggacctcaaggacattattgagcac
ctgaacatggctggtggccctgcagacaccagtgacccactgcagcagatctgcaagatc
ctcaatgcacacatggactcccttcagtgggtggaccagagctctgccctgctgcagagg
agggtggaggaggccagccgtgtgtgtgagagccggcgcaaggaacaggaacgcagcctg
cgcattgcctttgactag

DBGET integrated database retrieval system