KEGG   Rattus norvegicus (rat): 65984
Entry
65984             CDS       T01003                                 

Gene name
Aacs
Definition
(RefSeq) acetoacetyl-CoA synthetase
  KO
K01907  acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00280  Valine, leucine and isoleucine degradation
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    65984 (Aacs)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    65984 (Aacs)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    65984 (Aacs)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     65984 (Aacs)
Lipid biosynthesis proteins [BR:rno01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   65984 (Aacs)
SSDB
Motif
Pfam: AMP-binding ACAS_N
Other DBs
NCBI-GeneID: 65984
NCBI-ProteinID: NP_075592
RGD: 708522
Ensembl: ENSRNOG00000000967
UniProt: Q9JMI1
Position
12q14
AA seq 672 aa
MSKLARLEREEIMECQVMWEPDSKKDTQMDRFRAAVGTACGLALGNYDDLYHWSVRSYSD
FWAEFWKFSGIVCSRMYDEVVDTSKGIADVPEWFRGSRLNYAENLLRHKENDRVALYVAR
EGREEIAKVTFEELRQQVALFAAAMRKMGVKKGDRVVGYLPNSAHAVEAMLAAASIGAIW
SSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHGHLEKLQRVVKGLPDLQRVVLIP
YVLPREKIDISKIPNSMFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCM
VHSAGGTLIQHLKEHVLHGNMTSSDILLYYTTVGWMMWNWMVSALATGASLVLYDGSPLV
PTPNVLWDLVDRIGITILGTGAKWLSVLEEKDMKPMETHNLHTLHTILSTGSPLKAQSYE
YVYRCIKSTVLLGSISGGTDIISCFMGQNSSIPVYKGEIQARNLGMAVEAWDEEGKTVWG
ASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKYPGVWAHGDYCRINPKTGGIVMLGRS
DGTLNPNGVRFGSSEIYNIVEAFDEVEDSLCVPQYNRDGEERVVLFLKMASGHTFQPDLV
KHIRDAIRLGLSARHVPSLILETQGIPYTINGKKVEVAVKQVIAGKTVEHRGAFSNPESL
DLYRDIPELQDF
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgtccaagctggcacggctcgagcgcgaggagatcatggagtgccaggtgatgtgggag
cctgacagcaagaaggacacgcagatggaccgcttccgggcggccgtgggtactgcctgc
ggcctggcgcttgggaattacgatgacttataccactggtctgtccggtcgtattcagac
ttctgggctgagttctggaagttcagtggaattgtctgctctcgcatgtatgatgaggtt
gtggacacatccaaaggaattgcagatgtccctgagtggttcagaggcagccgcctcaac
tatgcagagaaccttctgcggcacaaggagaacgacagagtcgccctttacgtggcccgg
gaaggcagagaggagattgcgaaggtgactttcgaagagcttcggcagcaggtggctctg
tttgcagccgccatgaggaagatgggcgtgaagaaaggggaccgtgtggtcggttatctc
cccaacagtgcccatgccgtggaggccatgctggctgctgccagtattggagccatttgg
agttctacctcaccagactttggtgtgaatggtgtcctggaccgcttttctcaaattcag
ccgaaacttatcttctcggtggaagctgtggtctacaacggcaaggaacacggccacctg
gagaagctgcagcgagtcgtgaaaggacttcctgaccttcagcgagtggtgctgatcccc
tatgtcctcccaagggagaagatagacatttccaagatccccaacagcatgtttctggat
gacttcctggcaagcgggacaggtgcgcaggcaccacagctcgagtttgaacagctgccc
ttcagccatcccctgttcatcatgttctcctcgggcacgacaggagcgcccaagtgcatg
gtgcactctgctgggggcaccctcatccagcacctgaaggagcacgtgctacatggcaac
atgacaagcagtgacatcctgctctactacaccacggtcggctggatgatgtggaactgg
atggtgtcagcgctggccacaggagcatccttggttctgtacgatggctccccgctggtt
ccaacacccaatgtgttgtgggaccttgtggacaggataggaatcaccatcctgggaacg
ggagccaagtggctgtcagtgctggaggagaaggacatgaagccgatggaaactcacaac
ctccacacgctccacacgatcctgtccaccggctcgccactgaaagcccagagctatgag
tatgtgtacagatgcatcaagagcaccgtgctcctcggctccatctcaggtggcactgac
atcatctcctgtttcatgggccagaactcatctattcctgtgtacaagggtgagatccaa
gcccggaacctcggcatggccgtggaagcctgggacgaggaagggaaaaccgtctgggga
gcgagtggcgagctggtttgcaccaagcccataccctgccagcccacgcacttctggaac
gacgagaacggcagcaagtacaggaaggcttacttctccaaatacccaggtgtctgggca
cacggcgactactgcaggatcaaccccaagacaggaggtatcgtcatgttgggccggagt
gatggcaccctcaaccccaatggcgtacgctttggcagctcggagatctacaacattgtg
gaagccttcgatgaggtggaggacagcctttgtgtgccccagtacaacagggatggtgag
gagcgggtagtcctgtttctgaagatggcctctgggcacactttccagcccgacctcgtg
aagcacatccgtgatgccatccgccttggcctgtctgctcgccacgtgcccagcctcatc
ctggagacccaaggcattccatacacaatcaacggcaagaaagtggaggtggccgtgaag
caggtgatagctgggaagactgtggagcaccggggggccttctccaaccctgagtccctg
gacctgtatcgggacatccctgagctgcaggacttctga

DBGET integrated database retrieval system