KEGG   Rattus norvegicus (rat): 66021
Entry
66021             CDS       T01003                                 

Gene name
Cybb
Definition
(RefSeq) cytochrome b-245 beta chain
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04145  Phagosome
rno04216  Ferroptosis
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04670  Leukocyte transendothelial migration
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05140  Leishmaniasis
rno05171  Coronavirus disease - COVID-19
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    66021 (Cybb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    66021 (Cybb)
  09143 Cell growth and death
   04216 Ferroptosis
    66021 (Cybb)
   04217 Necroptosis
    66021 (Cybb)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    66021 (Cybb)
   04621 NOD-like receptor signaling pathway
    66021 (Cybb)
   04670 Leukocyte transendothelial migration
    66021 (Cybb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    66021 (Cybb)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    66021 (Cybb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66021 (Cybb)
   05020 Prion disease
    66021 (Cybb)
   05022 Pathways of neurodegeneration - multiple diseases
    66021 (Cybb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    66021 (Cybb)
   05415 Diabetic cardiomyopathy
    66021 (Cybb)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    66021 (Cybb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    66021 (Cybb)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     66021 (Cybb)
Membrane trafficking [BR:rno04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    66021 (Cybb)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Other DBs
NCBI-GeneID: 66021
NCBI-ProteinID: NP_076455
RGD: 620574
Ensembl: ENSRNOG00000003622
UniProt: Q9ER28
Position
X
AA seq 570 aa
MGNWAVNEGLSIFVILVWLGLNVFLFVKYYKVYDDEPKYNYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHL
FNVEWCVNARVGTSDPYSVALSNIGDKENEEYLNFAREKIKNPEGGLYVAVTRLAGITGI
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTSDSLKEHN
LDVCADKIKEWGKIKECPVPKFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFRMEVGQYIFVKRPAVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFKACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPSASIL
KSVWYKYCDNATSLRLKKIYFYWLCRDTHAFEWFADLLQLLETQMQERNNANFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAKTLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgagggactctccatctttgtcattctggtgtggttgggg
ctgaatgtcttcctctttgtcaagtattacaaggtttatgacgatgagcctaaatataat
tacactcgaaaacttcttgggtcagcactggctctggcccgggcacctgcagcctgcctg
aatttcaactgcatgctgatcttgctgccagtgtgtcggaatctcctctccttcctcagg
ggttccagtgcgtgttgctcaaccagaattcgaagacaactggacaggaaccttactttc
cataagatggtagcttggatgatagcacttcacacggccattcacaccattgcacatctg
ttcaacgtggagtggtgtgtgaatgccagagtcgggacttcggacccatattcagtagca
ctctctaacattggagacaaagaaaatgaagagtatctcaattttgctagagaaaaaatc
aagaaccctgaagggggcctgtatgtggctgtgactcggttggctggcatcacaggaatt
gtcatcacactgtgtcttatattgatcatcacatcctccaccaaaaccattcggaggtct
tactttgaagtgttctggtatacacaccatctctttgtgatcttcttcatcggccttgcc
atccatggagctgaacgaattgtacgtggacagacttcggacagtttgaaagagcataat
ttagatgtttgtgcagacaaaatcaaagaatggggaaaaataaaggagtgcccagtacca
aagtttgccggaaaccctcctatgacttggaaatggatcgtgggtcccatgttcctgtat
ctgtgtgagaggctggtgcggttttggcgatctcagcagaaggtggtcattaccaaggtg
gtcactcatcctttcaaaaccatcgagcttcagatgaagaagaagggattcaggatggag
gtgggacaatacattttcgtcaagcgtcccgcagtgtccaagctggagtggcaccctttc
accctgacctctgcccctgaggaagacttctttagcatccatatccgcattgttggcgac
tggacagagggactgttcaaagcctgtggctgtgataagcaggagtttcaagatgcctgg
aaactacctaagatagcagttgatgggccctttggtacagccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagctgggattggagtcacgccctctgcctccattctc
aagtctgtctggtacaaatattgtgacaatgccaccagtctgagactcaaaaagatctac
ttctactggctgtgcagggacacgcatgcttttgagtggttcgcagacctgctgcagctc
ctggagacccagatgcaagaaagaaacaatgccaacttcctcagctacaacatctacctt
actggctgggatgaatctcaggccaatcactttgctgtgcaccacgatgaggagaaagat
gtgattacaggcctaaaacagaagactctgtatggacggcccaactgggataacgagttc
aagaccattgcaagtcaacaccccaacaccagaataggagtttttctgtgtggccccgaa
gccttggctaaaactctcagtaaacagagcatctccaactctgagtccggcccacgtgga
gtccacttcatcttcaacaaggaaaacttctaa

DBGET integrated database retrieval system