KEGG   Rattus norvegicus (rat): 66022Help
Entry
66022             CDS       T01003                                 

Gene name
Kcns2
Definition
(RefSeq) potassium voltage-gated channel, modifier subfamily S, member 2
  KO
K04932  potassium voltage-gated channel delayed-rectifier subfamily S member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    66022 (Kcns2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   66022 (Kcns2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 66022
NCBI-ProteinID: NP_076456
RGD: 621525
Ensembl: ENSRNOG00000011369
UniProt: Q9ER26
Position
7q22
AA seq 477 aa AA seqDB search
MTRQSLWDLSETDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD
DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS
YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP
GYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF
ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESSPTLANLGRVAQVLRLM
RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT
IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccagagcctgtgggacctgtctgagaccgacgtcgaggatggagagatccga
atcaatgtaggcggcttcaagagacggctgcgttcccacacgctgctgcgcttccctgag
acacgcctgggccgtctgctcctctgccactcgagagaggccattctggaactctgcgat
gactacgacgatgtccagcgtgagttctacttcgaccgtaaccctgagctcttcccctac
gtgttgcatttctaccacaccggcaagctccatgtcatggccgagctgtgcgtcttctcc
ttcagccaggagatcgagtactggggtatcaacgagttctttattgactcttgctgcagc
tacagctatcacggccgcaaagtggaacctgagcaggagaagtgggacgagcagagtgac
caggaaagcactacttcctccttcgacgagatcttagccttctataatgatgcttccaag
ttcgatgggcaacccctgggcaacttccgcaggcagctgtggctggcgttggataacccg
ggctactcagtcctgagcagggtcttcagcgtcctttccatcttggtggtgttgggctcc
atcatcaccatgtgcctcaacagcctgccagacttccagatccccgatagccagggtaac
cctggcgaagaccccaggttcgaaatcgtggagcactttggcattgcctggttcacgttt
gagttggtggccaggttcgctgtggcccctgactttctcaagttcttcaagaatgcccta
aaccttattgacctcatgtccattgtcccgttttacataactctagtggtgaacctggtg
gtggagagttcgcctaccttggctaacttgggcagggtggctcaagtcctgaggctgatg
agaatcttccgaattctcaagctggccagacactccactggcctccggtccttgggggcc
accctgaagtacagctacaaggaagtggggttgctcttgctctacctctcggtggggatt
tccatcttctctgtggtggcctacaccattgaaaaggaagagaacgagggcctggccacc
attcctgcctgctggtggtgggccacggtcagcatgactaccgttgggtatggagacgtg
gtcccagggaccacagctgggaagctgactgcctctgcctgcatcttggcaggtatcctg
gtggtggtcttgcccatcactttgatcttcaataagttctcccacttttatcggcgccag
aagcaacttgagagcgccatgcgcagctgtgactttggggatggaatgaaggaggtcccc
tccgtcaatttaagggactactatgctcataaagttaagtccctcatggcaagcctgaca
aatatgagtaggagttcacccagtgaactgagtttagacgactctctacattag

DBGET integrated database retrieval system