KEGG   Rattus norvegicus (rat): 66024Help
Entry
66024             CDS       T01003                                 

Gene name
Npy2r
Definition
(RefSeq) neuropeptide Y receptor Y2
  KO
K04205  neuropeptide Y receptor type 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    66024 (Npy2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    66024 (Npy2r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    66024 (Npy2r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 66024
NCBI-ProteinID: NP_076458
RGD: 620475
Ensembl: ENSRNOG00000049213
UniProt: Q9ERC0
Position
2q34
AA seq 381 aa AA seqDB search
MGPLGAEADENQTVEVKVELYGSGPTTPRGELPPDPEPELIDSTKLVEVQVVLILAYCSI
ILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAASDHYHQRRHKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFKAK
KNLEVKKNNGLTDSFSEATNV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgggcccattaggtgcagaggcagatgagaatcaaactgtagaagtgaaagtggaactc
tatgggtcggggcccaccactcctagaggtgagttgccccctgatccagagccggagctc
atagacagcaccaaactggttgaggtgcaggtggtccttatactggcctattgttccatc
atcttgctgggcgtagttggcaactctctggtaatccatgtggtgatcaaattcaagagc
atgcgcacagtaaccaacttttttattgccaacctggctgtggcggatcttttggtgaac
accctgtgcctgccattcactcttacctataccttgatgggggagtggaaaatgggtcca
gttttgtgccatttggtgccctatgcccagggtctggcagtacaagtgtccacaataact
ttgacagtcattgctttggaccgacatcgttgcattgtctaccacctggagagcaagatc
tccaagcaaatcagcttcctgattattggcctggcgtggggtgtcagcgctctgctggca
agtccccttgccatcttccgggagtactcactgattgagattattcctgactttgagatt
gtagcctgtactgagaaatggcccggggaggagaagagtgtgtacggtacagtctacagc
ctttccaccctgctaatcctctacgttttgcctctgggcatcatatctttctcctacacc
cggatctggagtaagctaaagaaccacgttagtcctggagctgcaagtgaccattaccat
cagcgaaggcacaaaacgaccaaaatgctcgtgtgcgtggtagtggtgtttgcagtcagc
tggctgcccctccatgccttccaacttgctgtggacatcgacagccatgtcctggacctg
aaggagtacaaactcatcttcaccgtgttccacattattgcgatgtgctccaccttcgcc
aacccccttctctatggctggatgaacagcaactacagaaaagctttcctctcagccttc
cgctgtgagcagaggttggatgccattcactcggaggtgtccatgaccttcaaggctaaa
aagaacctggaagtcaaaaagaacaatggcctcactgactctttttcagaggccaccaac
gtgtaa

DBGET integrated database retrieval system