KEGG   Rattus norvegicus (rat): 66025Help
Entry
66025             CDS       T01003                                 

Gene name
Lpar3, Edg7
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    66025 (Lpar3)
   04072 Phospholipase D signaling pathway
    66025 (Lpar3)
   04151 PI3K-Akt signaling pathway
    66025 (Lpar3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    66025 (Lpar3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    66025 (Lpar3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    66025 (Lpar3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    66025 (Lpar3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 66025
NCBI-ProteinID: NP_076459
RGD: 620565
Ensembl: ENSRNOG00000015260
UniProt: Q8K5E0
Position
2q44
AA seq 345 aa AA seqDB search
MDFFYNRSNTDTADEWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVITNRKFHFPFYYLL
ANLAVADFFAGIAYVFLMFNTGPVSKTLTVNRWLLRQGLLDTSLTASLANLLVIAVERHM
SIMRMRIHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLAPIYSRSYLI
FWTVSNLLAFFIMVVVYVRIYMYVKRKTNVLSPHTSGSISRRRAPMKLMKTVMTVLGAFV
VCWTPGLVVLLLDGLNCKQCNVQHVKRWFLLLALLNSVMNPIIYSYKDEDMYNTMRKMIC
CAPHDSNAERHPSRIPSTIHSRSDTGSQYLEDSISQGQVCNKSSS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggactttttctacaacaggagcaacacagacacggcggacgagtggacggggacgaag
ctcgtgatcgtcctgtgcgttgggacattcttctgcctctttatatttttttctaactcc
ctggtcatcgcagcagtgatcacgaataggaagttccactttcccttctactacctgctg
gctaacttggcggtggcggatttctttgccggaatcgcttatgtgttcctgatgtttaac
accggcccggtgtcgaaaaccttgactgtcaaccgctggcttctccgccaggggctccta
gacacaagcctgacggcctccctggccaatctgctggtaattgctgtggaaagacacatg
tcaatcatgaggatgagaatccacagcaacttgaccaaaaaacgggtgacgctgctcatc
ctgctggtgtgggccatagccattttcatgggggcggtccccacgctgggctggaattgc
ctctgcaacatctcagcctgctcctctctggccccgatttacagcaggagttacctcatc
ttctggacggtgtcaaacctcctggccttcttcatcatggtggtggtgtacgtgcgcatc
tacatgtatgtcaagaggaaaaccaacgtcctctctccgcacacgagtggctccatcagc
cgccggagggcccccatgaagctaatgaagacggtgatgactgtcttaggagccttcgtg
gtgtgctggaccccgggtctcgtggtgctgctgctggacggcctgaactgcaagcagtgt
aatgtgcagcacgtgaagcgctggttcctgctgctggcgctgctcaactccgtcatgaac
cccatcatctactcgtacaaggacgaggacatgtacaacaccatgcggaagatgatctgc
tgtgccccgcacgacagcaacgccgagaggcacccctcccgcatcccctctaccatccac
agcaggagcgacacgggcagccagtacctggaggacagcatcagccagggccaggtgtgc
aataaaagcagctcctaa

DBGET integrated database retrieval system