KEGG   Rattus norvegicus (rat): 66028
Entry
66028             CDS       T01003                                 

Gene name
Arl6ip5, Gtrap3-18
Definition
(RefSeq) ADP-ribosylation factor like GTPase 6 interacting protein 5
  KO
K20393  PRA1 family protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    66028 (Arl6ip5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    66028 (Arl6ip5)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    66028 (Arl6ip5)
Transporters [BR:rno02000]
 Other transporters
  Others
   66028 (Arl6ip5)
SSDB
Motif
Pfam: PRA1 CitMHS Ac110_PIF
Other DBs
NCBI-GeneID: 66028
NCBI-ProteinID: NP_076462
RGD: 708572
Ensembl: ENSRNOG00000006818
UniProt: Q9ES40
Position
4q34
AA seq 188 aa
MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF
LSPFNMILGGIIVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVM
VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDSINKFA
DYISKARE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggacgtgaaccttgccccgctccgtgcctgggatgatttcttcccgggctctgatcgt
ttcgcacggccggacttcagggatatatccaaatggaacaaccgtgtagtgagcaatctg
ctctattaccagaccaactacctggtggtggctgccatgatgatttcagtcgttgggttt
ctgagccccttcaacatgatccttggaggaatcattgtggtgctggtgttcacggggttt
gtgtgggcagcacacaataaagacatcctccgccggatgaagaagcagtacccaacggcc
tttgtcatggtggtcatgctagccagctacttcctcatatccatgtttgggggtgtcatg
gtctttgtgtttggcatcacgtttcccttattgttgatgttcatccatgcatccctgaga
cttcgaaacctcaagaacaaactggaaaataaaatggagggaataggcttgaagaaaacg
ccgatgggcatcatcctggatgccttggaacagcaggaagacagcatcaataaatttgct
gactacatcagcaaagccagggagtaa

DBGET integrated database retrieval system