KEGG   Rattus norvegicus (rat): 66029
Entry
66029             CDS       T01003                                 

Gene name
Ido1
Definition
(RefSeq) indoleamine 2,3-dioxygenase 1
  KO
K00463  indoleamine 2,3-dioxygenase [EC:1.13.11.52]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno05143  African trypanosomiasis
Module
rno_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
rno_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    66029 (Ido1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    66029 (Ido1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.52  indoleamine 2,3-dioxygenase
     66029 (Ido1)
SSDB
Motif
Pfam: IDO
Other DBs
NCBI-GeneID: 66029
NCBI-ProteinID: NP_076463
RGD: 619989
Ensembl: ENSRNOG00000031189
UniProt: Q9ERD9
Position
16
AA seq 407 aa
MPHSQISPAEGSRRILEEYHIDEDVGFALPHPLEELPDTYRPWILVARNLPKLIENGKLR
EEVEKLPTLRTEELRGHRLQRLAHLALGYITMAYVWNRGDDDIRKVLPRNLAVPYCELSE
KLGLPPILSYADCVLANWKKKDPNGPMTYENMDILFSFPGGDCDKGFFLVSLMVEIAASP
AIKAIPTVSSAVEHQDPKALEKALCSIAASLEKAKEIFKRMRDFVDPDTFFHVLRIYLSG
WKGNPKLPEGLLYEGVWDTPKKFSGGSAGQSSIFQSLDVLLGIKHDVGEGSAAEFLQEMR
EYMPPAHRNFLSSLESAPPVREFVILRRNEDLKEAYNECVNGLVSLRMFHLSIVDTYIVK
PSKQKPMGGHKSEEPSNTENRGTGGTDVMNFLRSVKDTTKKALLSWP
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcctcacagtcaaatatctcctgcagaaggctctagaaggatccttgaagaataccac
atagatgaagatgtgggctttgctctaccacatccactggaggagctgcctgatacgtac
agaccttggatccttgtggctagaaatctgcctaagctgattgagaatgggaagctccga
gaagaagtcgagaagctgcccacactgcgcaccgaagaactgaggggacacaggttacag
cgcctggcacatttggccctggggtacatcaccatggcgtatgtgtggaaccgaggggat
gatgatattcgaaaggtgctgccccgcaatcttgccgttccctactgcgagctctcggag
aagctggggctgcctcccattctgtcttacgcagactgcgtcctggcaaactggaagaaa
aaggaccccaatgggcccatgacatacgagaacatggacattctgttctcgtttcctggt
ggggactgcgataaaggcttcttcctggtctctctaatggtggaaatcgcagcttctcct
gcaatcaaagcaattcctactgtatccagtgcagtagagcatcaagacccgaaagcactg
gagaaggcactgtgtagtatagctgccagtctggagaaagccaaggaaatttttaagagg
atgcgtgacttcgtggatccagacacctttttccacgttcttcgcatatatttgtctggt
tggaagggcaaccctaagctgccggagggtctgctgtacgagggcgtctgggacaccccc
aaaaaattttcagggggcagtgcaggccagagcagcatctttcagagtcttgatgtcctt
ctgggaataaagcatgacgttggtgaaggatctgctgcagaattcctccaggaaatgaga
gagtacatgcctccagcccaccggaacttcctctcctccttagagtcagctcccccagtc
cgtgagtttgtcattttaagacgcaatgaagacttgaaggaggcttataatgagtgtgtg
aatggcctggtctccctcagaatgttccacctctcgatagtagatacttacattgtgaag
ccttcgaagcagaagcccatgggtggccacaagtcagaagagccctcaaacacggaaaac
agagggactgggggtactgacgtcatgaatttcctgaggagtgtgaaagatacaaccaag
aaagcccttctgagttggccttag

KEGG   Rattus norvegicus (rat): 681319
Entry
681319            CDS       T01003                                 

Gene name
Ido2
Definition
(RefSeq) indoleamine 2,3-dioxygenase 2 isoform X1
  KO
K00463  indoleamine 2,3-dioxygenase [EC:1.13.11.52]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno05143  African trypanosomiasis
Module
rno_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
rno_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    681319 (Ido2)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    681319 (Ido2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.52  indoleamine 2,3-dioxygenase
     681319 (Ido2)
SSDB
Motif
Pfam: IDO DUF1864
Other DBs
NCBI-GeneID: 681319
NCBI-ProteinID: XP_008769597
RGD: 1596771
Ensembl: ENSRNOG00000025365
Position
16
AA seq 405 aa
MEAQRQDGKLASSLSLGKYHISEEYGFLLPNPLEELPDHYKPWMEIAHRLPHLIESHQLQ
AHVYEMPLLDCRFLTSYREQRLAHLVLAAITMGFVWQEGEAQPQKVLPRTLAIPFVEVSR
SLGLPPILVHSDLVLTNWTKRNPEGPLEIGNLETIISFPGGESLQGFILVTVLVEKAAVP
GIKALVLGVEAIRQHSQDTLLEALQQLRLSIQDITRALAQMHDYVDPEIFYLVIRIFLSG
WKDNPVMPVGLVYEGVSTEPLKYSGGSAAQSSVLHAFDEFLGIQHCKESVDFLHRMRDYM
PPSHKAFLEDLHSAPSLRDYILDSGPGGCLMAYNQCVEALGELRSYHINMVARYIISAAS
KARSRMLTRLSPHALEDRGTGGTAVLSFLKSVREKTMEAILCPGA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggaagctcaaagacaggatgggaagctggcatcgtcgttatccttgggaaaataccac
atttctgaggagtatggctttctccttccaaatcctctggaagaacttcccgaccattac
aagccttggatggaaattgcccacagacttcctcacttaatcgagagccaccagctccaa
gctcatgtgtacgagatgcctctcctggactgcaggttcctaacgagttaccgcgagcag
cgcctggcacacctggtgctggccgctatcactatgggattcgtctggcaggaaggggag
gcccaaccccaaaaggtgctgccaagaacacttgctattccttttgttgaggtatccagg
agcctgggactcccacctatcctggtccactctgatctggttctgacaaactggaccaaa
aggaacccagaaggaccactggaaatcggtaacctggagaccatcatctcttttccgggt
ggagagagcctgcagggcttcatactggtgacagtcttggtggagaaggcggcagtacct
ggcattaaggccctagttctgggagtggaggccattcggcaacacagccaggacaccctg
ctagaggccctgcagcagctgagactctccattcaggacattaccagagccttggcccaa
atgcacgattatgtagacccagaaatattttacttggtcatccggatcttcctctctggg
tggaaggacaacccagtcatgcccgtggggctggtctatgagggtgtttccacagagcct
ctgaagtactctggcggaagtgcagcccagagctccgtgcttcatgcctttgatgagttc
ctgggcattcagcattgcaaggaaagtgttgactttctacacagaatgagggactacatg
ccgccttcccataaggccttcctggaggacctccactcagccccttcactgagagactac
atactggactctggccctgggggctgcctgatggcctataaccagtgtgtggaggccctg
ggagagctgcgcagttaccacatcaacatggtggccagatacattatttccgctgccagc
aaggccaggagcaggatgctgactcgtctctcaccccatgccttggaagacaggggcact
gggggcactgctgtgctgagcttcttgaagagtgtcagggagaagaccatggaggccatc
ctgtgtcctggcgcttag

DBGET integrated database retrieval system