KEGG   Rattus norvegicus (rat): 66031
Entry
66031             CDS       T01003                                 

Gene name
Wdr7, Trag, Wd7
Definition
(RefSeq) WD repeat domain 7
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 66031
NCBI-ProteinID: NP_076465
RGD: 619836
Ensembl: ENSRNOG00000018387
UniProt: Q9ERH3
Position
18q12.1
AA seq 1488 aa
MAGNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDLSEELEVNPRALL
FGHTAAITCLSKACASGDKQYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQFYQFS
VGNQREGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAL
SVTGILKVWIVTSEISGLQDTEPIFEEESKPIYCQNCQSLSFCAFTQRSLLVVCSKYWRV
FDAGDYSLLCSGPSEDGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDV
GKAVENLIPPVQHSLLDQKDRELVICPPVTRFFYGCKEYLHKLLIQGDSSGRLSIWNIAD
IADKQEANEGLKTTTCISLQDAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGR
LVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARY
DQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHCVCSVASDH
SVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCTDGSVCVWQMDTGALDRCAMG
ITAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRRSLAALKNMAHHKLQTLATNLLASEA
SDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALIIQLLTEEASRPNTALISPENL
QKASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDEEEDEEEVMRQRREESDPEY
RASKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSR
GGHMSLMLPGYNQAAGKLLQAKAEAGRKGPATESVGKGTYTVSRAVTTQHLLSIISLANT
LMSMTNATFIGDHMKKGPTRPPRPGTPDLSKARDSPPASSNIVQGQIKQAAAPVSARSAA
DHSGSASASPALRTCFLVNEGWSQLAAMHCVMLPDLLGLGKFRPPLLEMLARRWQDRCLE
VREAAQALLLAELRRIEQAGRKETIDTWAPYLPQYMDHVISPGVTAEAMQTMAAAPDASG
PEAKVQEEEHDLVDDDITTGCLSSVPQMKKMSTSYEERRKQATAIVLLGVIGAEFGAEIE
PPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAI
DLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLI
ATARPPAFITTIAKEVHRHTALAANTQSQQSIHTTTLARAKGEILRVIEILIEKMPTDVV
DLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYDI
RTGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLR
CIKTYQVPPVQPASPGSHNALRLARLIWTSNRNVILMAHDGKEHRFMV
NT seq 4467 nt   +upstreamnt  +downstreamnt
atggcaggaaacagtctagttctgcccattgttctctggggccgcaaagcacccacacac
tgtatttcgtcaatactgctgacagatgatgggggcacgattgtgactggatgccacgat
ggacagatatgtctctgggatctctcagaagagctggaagttaatccccgagcactatta
tttggtcacacagcagccatcacttgtttgtcaaaagcctgtgcttctggagacaaacag
tacaccgtgagtgcgtccgcaaatggagagatgtgcctctgggatgtgaatgacggcaga
tgtattgaatttacaaaattagcctgcacacatactggcatacagttctaccagttctct
gttggaaatcagcgagagggaaggcttctgtgccatgggcattaccctgaaatcctcgtt
gtggatgccaccagccttgaggtgttgtattccttggtatcgaagatctctccagactgg
atcagctccatgagyatyatccgctctcaccggacacaagaggacactgtggtagcgctg
tccgtgacaggtattctgaaggtgtggattgtgacctctgaaattagtggattgcaggac
actgagccaatatttgaggaggaatccaaaccaatttattgtcagaattgccaaagcctc
tctttttgtgcattcacacagaggtcgctcttggttgtatgctccaagtactggagggtg
ttcgatgctggcgactactccctgctgtgttcaggtcctagtgaagatggacagacatgg
actggaggggactttgtgtctgcagacaaagtcattatttggactgaaaacgggcagagt
tacatttacaaactccctgccagttgccttccagctagtgattcattccgcagtgacgtg
gggaaagcagttgaaaatctgattcctcccgtgcagcatagcctcttggatcagaaggat
agagagttggtaatttgtcctcctgttactcggtttttctatggatgcaaggaatatttg
cataagctactaattcagggtgattcttctggaaggttaagtatttggaacatagcagac
atagcagacaaacaggaagccaatgaagggctaaaaacgacaacttgtattagtttgcaa
gatgcatttgacaaactgaagccttgtcctgctggaattatcgatcagctgagtgtgatt
ccaaacagcaacgaaccacttaaagtaactgcgagtgtctacataccagcacacgggcgc
cttgtttgcggccgggaagacggaagcatcattatcgtccctgccacccagacggccata
gttcagctgctgcagggagaacacatgctcagacgaggttggcccccgcacagaaccctc
cgtggccaccggaacaaagtcacgtgtttgctgtatcctcatcaggtctcagctcggtat
gatcaaagatacctgatatccggaggtgtggatttttccgtcatcatttgggacattttt
tccggagaaatgaaacatatcttctgtgttcatggtggtgagatcacacaacttctggtc
ccgccagaaaactgtagtgcaagagttcaacactgcgtctgttctgtggccagtgaccac
tctgtagggctgctaagtctgcgagagaaaaaatgcatcatgctggcgtctcgtcacctg
ttccctattcaggtgatcaagtggaggccttctgacgactacctggtggtggggtgcacg
gacggctctgtgtgtgtctggcagatggacactggtgcgctggaccgctgtgcaatgggg
ataacagccgtggagattctcaatgcttgtgacgaagctgtccctgcagcagtggactca
ctcagtcacccagcagtcaacctgaagcaagccatgacacggcggagtctcgccgccctt
aaaaacatggcccaccacaagctgcaaacccttgcaactaaccttttggcttctgaggcc
tctgacaaggggaatttacctaaatattctcataactccctgatggttcaagcaataaag
acaaacctaactgacccggatatccatgtgcttttctttgatgtggaagctttgattatt
caactcctgactgaagaagcctctaggccgaatactgcacttatttccccagagaatctg
cagaaagcatctggcagttcagacaaagggggctctttcctgactggaaaacgagcggca
gttcttttccagcaagtgaaagaaactatcaaagagaacataaaggagcacctccttgat
gaggaggaggacgaggaagaggtgatgaggcagaggagggaagaaagtgaccctgagtac
cgggccagcaagtccaaaccacttaccctactagaatacaaccttactatggataccgca
aaattattcatgtcctgtctccacgcctggggtttgaatgaagttctggatgaagtttgc
ctcgatcgcctcggcatgctgaaaccacactgcacagtgtcctttggtctcctatccaga
ggaggtcatatgtccttgatgcttcctggttataatcaggctgctggaaagctactgcag
gcgaaagcagaagcaggacggaaggggccagcaacggagagcgtaggcaaggggacctac
acagtgtcccgagcggtcaccacgcaacatctgttgtccatcatatctctggcaaatact
ttaatgagcatgaccaatgcgacgttcattggagatcacatgaagaagggccccaccagg
ccgcctagaccaggcaccccagacctttctaaggcaagggattcccccccagcctccagt
aacattgtgcaaggacagattaaacaagctgctgcgcctgtctctgctcggtctgccgcc
gaccactctggctctgcctctgcctctcctgctttacgtacctgcttcttagtgaatgaa
ggatggagccaactagctgccatgcactgtgtcatgctgccggacctgctggggctgggt
aaattcaggcctcctcttctggagatgctagctcgaagatggcaagatcggtgcttggag
gtgagagaggctgcacaggcccttcttctagcagagctgagaagaattgagcaggcagga
cggaaggagactattgatacctgggctccttacttacctcagtacatggaccatgtcata
tcacctggagtcacggcggaagccatgcagactatggcagctgctccagatgcctcgggg
ccagaagccaaagtccaggaagaagagcatgacctcgtggacgatgacatcaccactggt
tgcttatcaagtgtcccacaaatgaaaaagatgtccacatcttacgaagaaagaaggaag
caggccactgctattgttctcctgggagtgataggagcagagtttggagctgaaattgaa
ccaccaaaactgctgaccagacctcggagctctagtcaaattcctgaaggatttggtttg
acaagtggaggttccaactactctctggccagacatacgtgcaaggcactgacatttctt
ctgctacagccaccaagtcccaaacttcctcctcatagcaccatccggagaactgccatt
gacctgatcgggcgagggttcaccgtgtgggagccttacatggacgtgtctgctgtcctg
atggggctgctggagctgtgtgcagatgctgagaagcagctggccaacatcacaatgggg
ctgcctctgagccctgcagctgactctgcccgatccgcaagacacgccctttctctcata
gccaccgccagaccacccgccttcatcaccaccatagctaaggaggtgcacagacacacg
gcccttgcagcaaatacccagtcccagcagagtatccacaccaccacactggcaagggct
aaaggcgaaatcctgagagtcattgaaattcttatcgaaaagatgcctacggatgttgtg
gatcttcttgtggaggtcatggacatcatcatgtactgcctggaaggatctttagttaag
aagaagggtcttcaggagtgtttcccagccatctgcaggttctacatggtcagctattat
gagcggagtcacagaattgcagttggagcacgccatggctcagtggccctgtatgacatc
cggactgggaaatgtcagacaatccacggacacaagggacctatcactgcagtgtccttt
gctcctgatgggcgttaccttgccacctactcaaacactgacagccacatttctttctgg
cagatgaacacctcacttctgggaagcattggcatgctgaactcagcacctcagctgcgc
tgcatcaagacctaccaggtacctccagtgcagcccgcatcccctggctcgcacaacgcc
ctcaggttggcccggctcatctggacttccaaccggaatgttatcctcatggcccacgat
gggaaggagcaccgcttcatggtctga

DBGET integrated database retrieval system