KEGG   Rattus norvegicus (rat): 679091
Entry
679091            CDS       T01003                                 

Gene name
Mettl1
Definition
(RefSeq) methyltransferase like 1
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    679091 (Mettl1)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     679091 (Mettl1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    679091 (Mettl1)
 Prokaryotic type
    679091 (Mettl1)
SSDB
Motif
Pfam: Methyltransf_4 Methyltransf_25 Methyltransf_12 MTS
Other DBs
NCBI-GeneID: 679091
NCBI-ProteinID: XP_001054797
RGD: 1593036
Ensembl: ENSRNOG00000047895
UniProt: M0R637
Position
7q22
AA seq 267 aa
MAGAEAPQPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPPNQNKSHDDPK
DEKEKHSGAQVEFADIGCGYGGLLVALSPLFPDTLILGLEIRVKVSDYVQDRIRALRATP
GGGFQNIACLRSNAMKHLPNFFRKGQLAKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYV
LRVGGLVYTITDVLELHEWMCTHFEEHPLFEHVPLEELSEDPVVEHLGTSTEEGKKVLRN
NGKNFPAIFRRIQDPLLQAVTPNPTLP
NT seq 804 nt   +upstreamnt  +downstreamnt
atggcgggagccgaggccccccagccgcagaagcgctactaccggcagcgcgcccactcc
aaccctatggcggaccacacactgcgctaccctgtgaagccagaggagatggactggtct
gagctttacccagagttctttgctccacctaatcaaaacaagagccatgatgatccaaag
gatgagaaagaaaagcactctggggcccaagtggagtttgcagacataggctgtggctat
ggtggcttgttagtggcactgtcaccgctcttcccagataccctgattctgggtctggaa
attcgggtgaaggtgtccgactatgtgcaagacaggattcgggccctccgtgcaactccc
ggaggtggattccagaacatcgcctgtctccgcagtaacgccatgaagcaccttcctaac
ttcttccgcaagggccagctggcaaagatgttcttcctctttcccgacccacactttaag
cgaacgaagcataaatggcgaatcatcagccccacacttctggcagagtatgcctacgtg
ctgagagtcgggggcctggtatacaccatcaccgatgtcctggaactgcacgaatggatg
tgcacccattttgaagagcacccactatttgagcatgtgcctctggaagagctaagtgaa
gaccccgttgtggaacatctaggcacttcaactgaggaaggaaagaaagttctacgcaac
aatggaaagaatttcccagccatcttccgaagaatacaggatcccctcctccaggcagtg
acccccaatcccaccctaccttag

DBGET integrated database retrieval system