KEGG   Rattus norvegicus (rat): 679572Help
Entry
679572            CDS       T01003                                 

Gene name
Romo1
Definition
(RefSeq) reactive oxygen species modulator 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Romo1 Tim17 TCRP1
Motif
Other DBs
NCBI-GeneID: 679572
NCBI-ProteinID: NP_001182419
RGD: 1587111
Ensembl: ENSRNOG00000019823
UniProt: D4A742
Position
3q42
AA seq 79 aa AA seqDB search
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggctgtgggtccctacgggcagtcccagcccagctgcttcgaccgcgtgaag
atgggctttgtcatgggttgcgccgtgggtatggcggccggggccctgttcggcaccttc
tcctgtctcaggatcggaatgcggggtcgggagctgatgggcggcattgggaaaaccatg
atgcagagtggcggtacctttggcactttcatggccatcggaatgggcatacgatgctaa

DBGET integrated database retrieval system