KEGG   Rattus norvegicus (rat): 679629Help
Entry
679629            CDS       T01003                                 

Gene name
Smtnl2
Definition
(RefSeq) smoothelin-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CH CAMSAP_CH SlyX KASH_CCD HALZ DUF4164 Cecropin bZIP_2
Motif
Other DBs
NCBI-GeneID: 679629
NCBI-ProteinID: NP_001177927
RGD: 1585960
Ensembl: ENSRNOG00000015157
UniProt: D3ZUC1
Position
10q24
AA seq 456 aa AA seqDB search
MEPTPDAEEAHTVREALGRYEAALEGAVRALHEDMQGLQRGVERRVAEALRLAGPLARTV
AELQRDNQRLQAQLERLTRQVEALGLATGVSPAPGTPSPPPATTVTDRAPRLGTARFSSH
ATFSLSGRSPSMEHDEVSDLEARRTSNSCIMENGHQLDAGSANGSSEVQASSAQESPRPR
PVSLSLRLPHQPVTAVTRVSEKFSGETSASALSPTSAAIVGGFTPSPSEAISPWTPSPTE
KSSSFTRSLSGSGYGAVTAGKRKDSPPLVTPPQSPPSSQPPAMTQAPRQGERRRELVRSQ
TLPRTSGAQARKALFEKWEQDTASKGKGETRAKLKRSQSFGVASASSIKQILLEWCRSKT
VGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANC
ERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggagccaacccccgacgccgaggaggcgcacacggtgcgcgaggcgctgggccgctat
gaagcggcgctggagggtgccgtgcgtgcgctgcacgaggacatgcaggggctgcagcgc
ggcgtggagcggcgcgtggccgaggcgctgcgcctggctggccccttggctcgcactgtg
gccgagctgcagcgggacaaccagaggttgcaggcgcagctcgaacgcttgacccgccag
gtggaggcgctgggcttggcgactggtgtgtcccctgcacccggcacgcctagtccgcct
ccagcgaccacggttacagaccgcgccccccgcctgggcaccgcgcgcttctccagtcat
gctacattctcgctgtccggtcgaagcccgagcatggaacatgatgaagtcagtgacctc
gaggcgagacgaacttcaaactcatgcatcatggagaatggacaccagctggatgcaggt
tcagccaacggatcctctgaggtccaagcctcatcagcccaggagtcccctagaccacgc
cctgtgagcctctccttgcggctgccccaccagccggtcacagctgtcacccgagtctct
gagaaattctctggggagacctcagcttcagctctgtcacccacatctgctgctattgtg
gggggcttcaccccaagccctagtgaggccatcagtccttggactcctagtcccactgag
aaaagttcctccttcacacggtctttgtctggctctgggtatggagcagtgacagctggc
aaacgcaaggacagccctccactggtgaccccaccacagtcacccccatcctcacagcct
ccagctatgactcaggcccctcgccagggagagcgtcgcagggaactggtgaggtcgcag
acgctgcctcgtacttcaggggcgcaggctcggaaggcgctgtttgagaagtgggagcag
gacacagcaagcaagggcaaaggtgagaccagggccaaactaaagaggtcgcagagtttc
ggtgtggccagtgccagcagcatcaagcagatcctgctcgagtggtgccgcagcaagact
gtgggctatcagcatgtggacctgcagaatttctcctccagctggagtgatgggatggcc
ttctgtgccctagtgcactcattcttccctgatgccttcgactacaatgccctgagtccc
acacaaaggcagaagaactttgaactggccttcaccatggctgagaatctggccaactgt
gagcgcctcattgaagtggaggatatgatggtgatgggccgcaagccggaccccatgtgc
gttttcacctacgtgcagtcgctctacaaccacctgcgtcgctttgagtaa

DBGET integrated database retrieval system