KEGG   Rattus norvegicus (rat): 679739Help
Entry
679739            CDS       T01003                                 

Definition
(RefSeq) NADH dehydrogenase (ubiquinone) Fe-S protein 6
  KO
K03939  NADH dehydrogenase (ubiquinone) Fe-S protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    679739
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    679739
  09159 Environmental adaptation
   04714 Thermogenesis
    679739
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    679739
   05012 Parkinson disease
    679739
   05016 Huntington disease
    679739
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    679739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CHCC Thiolase_C
Motif
Other DBs
NCBI-GeneID: 679739
NCBI-ProteinID: XP_001053017
RGD: 1584802
Ensembl: ENSRNOG00000049394
Vega: OTTRNOG00000001218
UniProt: D3ZCZ9
Position
1p11
AA seq 116 aa AA seqDB search
MAAALTFRRLLALPRAARGFGVRVSRSGEKITHTGQVYDEKDYRRIRFVDRQKEVNENFA
IDLIAQQPVNEVDHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQQHH
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgctgaccttccgccggctgttggctctccctagggctgcccggggcttc
ggggtgcgagtgtcgcggagcggggagaagatcacgcataccggccaggtgtatgatgaa
aaagactacaggaggattcgttttgtagatcgtcagaaagaggtgaatgagaactttgcc
attgatttgatagcacaacaacctgtgaatgaggtggaccatcgtatcatagcctgtgat
ggagggggtggagccttgggccaccccaaggtgtatataaacctggacaaagaaacaaaa
acgggtacgtgtggctactgcggcctgcagttcaagcagcagcatcactag

DBGET integrated database retrieval system