KEGG   Rattus norvegicus (rat): 679784
Entry
679784            CDS       T01003                                 

Gene name
Slc17a4
Definition
(RefSeq) solute carrier family 17, member 4
  KO
K12300  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 1/2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    679784 (Slc17a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   679784 (Slc17a4)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    679784 (Slc17a4)
SSDB
Motif
Pfam: MFS_1 SOSSC
Other DBs
NCBI-GeneID: 679784
NCBI-ProteinID: NP_001258143
RGD: 1584758
Ensembl: ENSRNOG00000022505
UniProt: A0A0G2JXU5
Position
17p11
AA seq 495 aa
MSTGADLKAREGGIPNDSNLNMTQEQSFKKGCCSLRHGLAFILHLCNFSVYTQQMNLSIA
ITAMVNTTAASSHANASIERPTTDSQDFWNETLQESKAPVYDWTPEIQGILLSSLNYGSF
LAPIPTGYVAGVFGAKYVVGLGLLVSSVLTLFIPLAAEAGVALLIVLRVIQGMSQVMVLT
GQYSMWAKWAPPLERSQLITIAASGSMLGTFLVLIAGGLLCQALGWPYIFYIFGGIGCAC
CLLWFPLVYDDPQNHPFISTGEKRYIMCSLAQEDCSLGWSLPIKAMVKSLPLWAIVVSYF
CEYWLLFTIMAYTPTYISSVLQANLRDSGILSALPFMFGCVCIILGGLLADFLLSRNILR
LVTIRKLFTALGVLVSSGILVPLPWVSSSLSTTMAFLVLSSVFASLCDSGALINFLDIAP
RYAGFLKGLLQVFSYLAGGIAPTVAGFFISQDSEFGWRNVFLLAAAIDVVGLLFYLIFGR
AEVQDWAKEPTFTHL
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgtctactggagcagacctcaaggcgagagagggaggcattcccaatgacagcaattta
aacatgacccaagaacaatccttcaagaaaggctgctgctcactgcgccatggtttggct
ttcatcttgcatctctgtaatttttctgtttatacccaacaaatgaacctgagcatcgcc
ataacagctatggtgaacaccacagcagcatccagccatgccaacgcttccatagaaagg
cctaccactgactcccaagatttctggaatgaaacactacaggaatctaaggcccctgtt
tacgactggacacctgagatccagggaatcctcctcagctctctcaactatggatcgttc
ttagctccaatccctactggctatgtggctggagtgtttggagccaagtatgtggttggt
ttgggcttgttagtttcttccgtcctgactctcttcattccactggcagctgaggctgga
gtagccttactaattgtccttcgggtcatccaaggcatgtctcaggttatggtgttaaca
ggtcagtactcaatgtgggccaaatgggctcccccactggaaaggagtcagctcatcacc
atcgctgcatcagggtcaatgcttggaacgttccttgttcttattgctggtggtcttctt
tgccaggccctaggatggccttatatattctacatctttggtggaattggctgtgcctgt
tgcctgctctggttccccctcgtatatgatgacccacagaatcatccctttatcagcact
ggtgagaagagatacatcatgtgttcactggctcaagaggattgctcgctgggctggtct
cttcccattaaagccatggtgaaatctctcccactttgggccattgtggtttcatatttc
tgtgaatactggctattattcacgataatggcatatacacccacatatatcagctctgta
cttcaagcaaatctccgagatagtggaatcctgtctgccctgccattcatgttcggctgt
gtctgcattattcttgggggtctactggcagattttctcctctccaggaacatcctccgg
cttgtaaccatcaggaagctcttcactgccctaggggtccttgtctcatccgggatcctt
gtgcccctaccttgggtcagctccagcctcagcactacaatggccttcttggtactatct
tctgtctttgccagcctctgtgattcaggagccctcattaacttcttggatatagctcca
cggtatgctggctttctcaaaggactattgcaagtcttttcttacttagctggaggcata
gctcctactgttgctggatttttcatcagtcaggattcagagtttggctggagaaatgtc
ttcttacttgcagctgctattgatgtagtcggcctgctcttctacctcatcttcggcaga
gcagaggtacaggactgggctaaggaaccaacattcacccatctctga

DBGET integrated database retrieval system