KEGG   Rattus norvegicus (rat): 679822Help
Entry
679822            CDS       T01003                                 

Definition
(RefSeq) similar to dynein, cytoplasmic, light peptide
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Dynein_light 23ISL
Motif
Other DBs
NCBI-GeneID: 679822
NCBI-ProteinID: XP_006220618
RGD: 1583666
Ensembl: ENSRNOG00000061035
UniProt: A0A0G2JWE4
Position
10q11
AA seq 92 aa AA seqDB search
MVTMCDWKVVITNADMSEGMQQDSVERAAQALEKCSMEKGIAAPSKEESDKKSNPTRHCI
VGRTSGSYGTHETKPFIHFSLGQVAVLLFKSG
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccatgtgcgactggaaggtggtgatcacaaacgcagacatgtcggaagggatg
caacaggactcggtggagcgcgctgctcaggcgctggagaagtgcagcatggagaagggt
atcgcggcccctagcaaggaggagtctgataagaagtccaaccccacccggcactgcatc
gtgggccggacctccggtagctacgggacacatgagaccaaacccttcatccacttctcc
ctgggtcaggtggccgttcttctgttcaaatctggttaa

DBGET integrated database retrieval system