KEGG   Rattus norvegicus (rat): 679949Help
Entry
679949            CDS       T01003                                 

Gene name
Ube2ql1
Definition
(RefSeq) ubiquitin-conjugating enzyme E2Q family-like 1
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    679949 (Ube2ql1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    679949 (Ube2ql1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     679949 (Ube2ql1)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   679949 (Ube2ql1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B
Motif
Other DBs
NCBI-GeneID: 679949
NCBI-ProteinID: NP_001138635
RGD: 1598121
Ensembl: ENSRNOG00000034075
UniProt: D3ZXV0
Position
1p11
AA seq 304 aa AA seqDB search
MATLLRKIGLIRLHNRDTEDPKHHHNHRGGGGGQQSASLRGKGGGKSGGHKQQQQQQHPG
GSGDASPGPGKGKSKRAAELAARDKQPQPAAGAAGVAGAGGPRERAAGARAGPGPAVAAA
AAGGSLVPAARQQHCTQVRSRRLMKELQDIARLSDRFISVELVNENLFDWNVKLHQVDKD
SVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGW
SSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPP
VSDG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgctccgtaaaatcgggctcattcgcctgcacaaccgggacaccgaggac
cccaagcaccaccacaaccaccgcggcggaggcggcggccagcagagcgcatcgctgcgc
ggcaaaggtggtggtaagagcggtggccacaagcagcagcagcaacagcagcaccccggg
ggctccggcgacgccagcccggggcccggcaagggcaagagtaagcgcgcggcggagctg
gccgcgcgcgacaagcagccacagccagccgcgggggcggcgggggtggcgggcgccggg
ggcccccgagagcgggcggcgggcgccagggcggggccgggccccgcggtggccgcggcg
gcggcgggcggcagcctggtgcccgcggcgcgccagcagcactgcacacaggtgcgcagc
cggcggctcatgaaggagctccaggacatcgcgcgcctcagcgaccgcttcatctcggtg
gagctggtaaatgagaacctcttcgactggaacgtgaagctgcaccaggtggacaaggac
tcggtgctgtggcaggacatgaaggagaccaacacggagttcatcctgctcaacctcacc
ttcccggataacttccccttctcgccgcccttcatgcgggtgctcagtccgcgactggaa
aacggctacgtgctggacggaggcgccatctgcatggagctgctcacgccgcgcggctgg
tccagcgcctacacggtggaggccgtcatgcgccagtttgctgccagcctggtcaagggc
cagggacggatctgcagaaaagccggcaagtcaaaaaagtccttcagccgcaaggaagct
gaagcaacctttaagagtttggtgaagacacatgagaaatacggctgggtcaccccgccc
gtgtctgacggctga

DBGET integrated database retrieval system